data_1I17 # _entry.id 1I17 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1I17 pdb_00001i17 10.2210/pdb1i17/pdb RCSB RCSB012777 ? ? WWPDB D_1000012777 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1I17 _pdbx_database_status.recvd_initial_deposition_date 2001-01-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mo, H.' 1 'Moore, R.C.' 2 'Cohen, F.E.' 3 'Westaway, D.' 4 'Prusiner, S.B.' 5 'Wright, P.E.' 6 'Dyson, H.J.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Two different neurodegenerative diseases caused by proteins with similar structures.' Proc.Natl.Acad.Sci.USA 98 2352 2357 2001 PNASA6 US 0027-8424 0040 ? 11226243 10.1073/pnas.051627998 1 'Ataxia in Prion Protein (PrP)-Deficient Mice is Associated with Upregulation of the Novel PrP-like Protein Doppel' J.Mol.Biol. 292 797 817 1999 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1999.3108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mo, H.' 1 ? primary 'Moore, R.C.' 2 ? primary 'Cohen, F.E.' 3 ? primary 'Westaway, D.' 4 ? primary 'Prusiner, S.B.' 5 ? primary 'Wright, P.E.' 6 ? primary 'Dyson, H.J.' 7 ? 1 'Moore, R.C.' 8 ? 1 'Lee, I.Y.' 9 ? 1 'Silverman, G.L.' 10 ? 1 'Harrison, P.M.' 11 ? 1 'Strome, R.' 12 ? 1 'Heinrich, C.' 13 ? 1 'Karunaratne, A.' 14 ? 1 'Pasternak, S.H.' 15 ? 1 'Chishti, M.A.' 16 ? 1 'Liang, Y.' 17 ? 1 'Mastrangelo, P.' 18 ? 1 'Wang, K.' 19 ? 1 'Smit, A.F.' 20 ? 1 'Katamine, S.' 21 ? 1 'Carlson, G.A.' 22 ? 1 'Cohen, F.E.' 23 ? 1 'Prusiner, S.B.' 24 ? 1 'Melton, D.W.' 25 ? 1 'Tremblay, P.' 26 ? 1 'Hood, L.E.' 27 ? 1 'Westaway, D.' 28 ? # _cell.entry_id 1I17 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1I17 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PRION-LIKE PROTEIN' _entity.formula_weight 12297.794 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'GLOBULAR DOMAIN (RESIDUES 51-157)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MOUSE DOPPEL' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKL HQRVLWRLIKEICSAKHCDFWLERGAA ; _entity_poly.pdbx_seq_one_letter_code_can ;RVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKL HQRVLWRLIKEICSAKHCDFWLERGAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 VAL n 1 3 ALA n 1 4 GLU n 1 5 ASN n 1 6 ARG n 1 7 PRO n 1 8 GLY n 1 9 ALA n 1 10 PHE n 1 11 ILE n 1 12 LYS n 1 13 GLN n 1 14 GLY n 1 15 ARG n 1 16 LYS n 1 17 LEU n 1 18 ASP n 1 19 ILE n 1 20 ASP n 1 21 PHE n 1 22 GLY n 1 23 ALA n 1 24 GLU n 1 25 GLY n 1 26 ASN n 1 27 ARG n 1 28 TYR n 1 29 TYR n 1 30 ALA n 1 31 ALA n 1 32 ASN n 1 33 TYR n 1 34 TRP n 1 35 GLN n 1 36 PHE n 1 37 PRO n 1 38 ASP n 1 39 GLY n 1 40 ILE n 1 41 TYR n 1 42 TYR n 1 43 GLU n 1 44 GLY n 1 45 CYS n 1 46 SER n 1 47 GLU n 1 48 ALA n 1 49 ASN n 1 50 VAL n 1 51 THR n 1 52 LYS n 1 53 GLU n 1 54 MET n 1 55 LEU n 1 56 VAL n 1 57 THR n 1 58 SER n 1 59 CYS n 1 60 VAL n 1 61 ASN n 1 62 ALA n 1 63 THR n 1 64 GLN n 1 65 ALA n 1 66 ALA n 1 67 ASN n 1 68 GLN n 1 69 ALA n 1 70 GLU n 1 71 PHE n 1 72 SER n 1 73 ARG n 1 74 GLU n 1 75 LYS n 1 76 GLN n 1 77 ASP n 1 78 SER n 1 79 LYS n 1 80 LEU n 1 81 HIS n 1 82 GLN n 1 83 ARG n 1 84 VAL n 1 85 LEU n 1 86 TRP n 1 87 ARG n 1 88 LEU n 1 89 ILE n 1 90 LYS n 1 91 GLU n 1 92 ILE n 1 93 CYS n 1 94 SER n 1 95 ALA n 1 96 LYS n 1 97 HIS n 1 98 CYS n 1 99 ASP n 1 100 PHE n 1 101 TRP n 1 102 LEU n 1 103 GLU n 1 104 ARG n 1 105 GLY n 1 106 ALA n 1 107 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET21A(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRND_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKL HQRVLWRLIKEICSAKHCDFWLERGAA ; _struct_ref.pdbx_align_begin 51 _struct_ref.pdbx_db_accession Q9QUG3 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1I17 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9QUG3 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 157 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 299 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02M _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '4mM 15N or 2mM 15N/13C protein 20mM d3-NaOAc, pH5.2' _pdbx_nmr_sample_details.solvent_system 'D2O:H2O = 1:9' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DRX 800 # _pdbx_nmr_refine.entry_id 1I17 _pdbx_nmr_refine.method 'distance geometry molecular dynamics simulated annealing' _pdbx_nmr_refine.details 'based on 1311 distance restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1I17 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 1I17 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1I17 _pdbx_nmr_representative.conformer_id 16 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' Guentert 1 Amber 7 refinement Case 2 # _exptl.entry_id 1I17 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1I17 _struct.title 'NMR STRUCTURE OF MOUSE DOPPEL 51-157' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1I17 _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'mouse doppel, doppel, dpl, prion, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 22 ? TYR A 33 ? GLY A 22 TYR A 33 1 ? 12 HELX_P HELX_P2 2 TRP A 34 ? PHE A 36 ? TRP A 34 PHE A 36 5 ? 3 HELX_P HELX_P3 3 THR A 51 ? ASN A 67 ? THR A 51 ASN A 67 1 ? 17 HELX_P HELX_P4 4 ASN A 67 ? GLN A 76 ? ASN A 67 GLN A 76 1 ? 10 HELX_P HELX_P5 5 SER A 78 ? LYS A 96 ? SER A 78 LYS A 96 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 45 A CYS 98 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf2 disulf ? ? A CYS 59 SG ? ? ? 1_555 A CYS 93 SG ? ? A CYS 59 A CYS 93 1_555 ? ? ? ? ? ? ? 2.043 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 9 ? ILE A 11 ? ALA A 9 ILE A 11 A 2 GLY A 39 ? TYR A 41 ? GLY A 39 TYR A 41 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 11 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 39 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 39 # _database_PDB_matrix.entry_id 1I17 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1I17 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ALA 107 107 107 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-03-07 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 104 ? ? CZ A ARG 104 ? ? NH1 A ARG 104 ? ? 124.05 120.30 3.75 0.50 N 2 3 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.62 120.30 3.32 0.50 N 3 4 NE A ARG 1 ? ? CZ A ARG 1 ? ? NH1 A ARG 1 ? ? 124.44 120.30 4.14 0.50 N 4 4 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.00 120.30 3.70 0.50 N 5 5 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.41 120.30 3.11 0.50 N 6 7 NE A ARG 1 ? ? CZ A ARG 1 ? ? NH1 A ARG 1 ? ? 123.97 120.30 3.67 0.50 N 7 8 NE A ARG 1 ? ? CZ A ARG 1 ? ? NH1 A ARG 1 ? ? 123.45 120.30 3.15 0.50 N 8 8 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 123.48 120.30 3.18 0.50 N 9 9 NE A ARG 1 ? ? CZ A ARG 1 ? ? NH1 A ARG 1 ? ? 123.65 120.30 3.35 0.50 N 10 10 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.46 120.30 3.16 0.50 N 11 10 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.49 120.30 3.19 0.50 N 12 12 NE A ARG 1 ? ? CZ A ARG 1 ? ? NH1 A ARG 1 ? ? 123.41 120.30 3.11 0.50 N 13 13 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 123.89 120.30 3.59 0.50 N 14 14 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.65 120.30 3.35 0.50 N 15 14 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 123.49 120.30 3.19 0.50 N 16 15 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.93 120.30 3.63 0.50 N 17 16 NE A ARG 15 ? ? CZ A ARG 15 ? ? NH1 A ARG 15 ? ? 123.49 120.30 3.19 0.50 N 18 18 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.69 120.30 3.39 0.50 N 19 19 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.37 120.30 3.07 0.50 N 20 20 NE A ARG 1 ? ? CZ A ARG 1 ? ? NH1 A ARG 1 ? ? 123.58 120.30 3.28 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 3 ? ? -75.33 37.30 2 1 SER A 46 ? ? -141.70 -58.71 3 1 ASP A 77 ? ? -130.32 -45.33 4 2 SER A 46 ? ? -137.84 -58.72 5 2 GLU A 74 ? ? -79.92 47.23 6 2 LYS A 75 ? ? -147.29 -33.55 7 2 LYS A 79 ? ? -124.57 -59.59 8 3 VAL A 2 ? ? -91.65 -82.40 9 3 ALA A 3 ? ? -153.92 -159.70 10 3 SER A 46 ? ? -131.83 -57.27 11 3 GLU A 74 ? ? -79.84 46.80 12 3 LYS A 75 ? ? -155.31 -61.46 13 3 LYS A 96 ? ? -72.99 49.80 14 4 CYS A 45 ? ? -55.54 109.23 15 4 SER A 46 ? ? -125.81 -56.25 16 4 ASP A 77 ? ? -136.72 -39.91 17 5 SER A 46 ? ? -139.31 -58.40 18 6 ASP A 77 ? ? -138.10 -37.21 19 7 SER A 46 ? ? -144.68 -61.09 20 7 ASP A 77 ? ? -135.10 -40.22 21 8 SER A 46 ? ? -145.91 -50.81 22 8 LYS A 75 ? ? -142.37 -53.68 23 8 SER A 78 ? ? -143.84 37.17 24 9 SER A 46 ? ? -139.06 -58.61 25 9 LEU A 102 ? ? -124.18 -162.77 26 9 ALA A 106 ? ? -67.18 92.64 27 10 SER A 46 ? ? -148.02 -51.40 28 10 TRP A 101 ? ? -67.32 84.31 29 11 LYS A 12 ? ? -101.77 73.52 30 11 SER A 46 ? ? -132.26 -61.90 31 11 ASP A 77 ? ? -132.93 -40.92 32 11 LYS A 79 ? ? -120.73 -67.69 33 12 SER A 46 ? ? -146.55 -52.52 34 12 ASP A 77 ? ? -135.49 -35.04 35 12 GLU A 103 ? ? -139.49 -74.21 36 13 LYS A 16 ? ? -46.26 105.77 37 13 SER A 46 ? ? -136.87 -59.32 38 13 GLU A 74 ? ? -74.49 43.67 39 13 LYS A 75 ? ? -155.31 -62.47 40 13 ARG A 104 ? ? -141.90 -59.31 41 14 SER A 46 ? ? -140.76 -60.19 42 14 ASP A 77 ? ? -136.72 -36.78 43 15 SER A 46 ? ? -147.30 -47.23 44 15 ASP A 77 ? ? -135.76 -40.31 45 16 SER A 46 ? ? -139.94 -59.47 46 16 LYS A 79 ? ? -121.33 -77.76 47 17 SER A 46 ? ? -145.52 -52.61 48 17 ASP A 77 ? ? -135.25 -44.27 49 17 LYS A 79 ? ? -120.40 -76.38 50 17 GLU A 103 ? ? -140.09 -65.48 51 18 SER A 72 ? ? -132.93 -58.80 52 18 SER A 78 ? ? -80.62 49.96 53 18 ARG A 104 ? ? -138.12 -77.07 54 19 LYS A 75 ? ? -147.32 -53.19 55 19 LYS A 96 ? ? -67.52 92.28 56 20 SER A 46 ? ? -142.23 -77.74 57 20 ASP A 77 ? ? -133.17 -39.92 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 3 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 41 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.069 _pdbx_validate_planes.type 'SIDE CHAIN' #