data_1IAM # _entry.id 1IAM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IAM pdb_00001iam 10.2210/pdb1iam/pdb WWPDB D_1000174091 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IAM _pdbx_database_status.recvd_initial_deposition_date 1998-02-22 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bella, J.' 1 'Kolatkar, P.R.' 2 'Marlor, C.' 3 'Greve, J.M.' 4 'Rossmann, M.G.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The structure of the two amino-terminal domains of human ICAM-1 suggests how it functions as a rhinovirus receptor and as an LFA-1 integrin ligand. ; Proc.Natl.Acad.Sci.USA 95 4140 4145 1998 PNASA6 US 0027-8424 0040 ? 9539703 10.1073/pnas.95.8.4140 1 'Structure of a Human Rhinovirus Complexed with its Receptor Molecule' Proc.Natl.Acad.Sci.USA 90 507 ? 1993 PNASA6 US 0027-8424 0040 ? ? ? 2 'The Major Human Rhinovirus Receptor is Icam-1' 'Cell(Cambridge,Mass.)' 56 839 ? 1989 CELLB5 US 0092-8674 0998 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bella, J.' 1 ? primary 'Kolatkar, P.R.' 2 ? primary 'Marlor, C.W.' 3 ? primary 'Greve, J.M.' 4 ? primary 'Rossmann, M.G.' 5 ? 1 'Olson, N.H.' 6 ? 1 'Kolatkar, P.R.' 7 ? 1 'Oliveira, M.A.' 8 ? 1 'Cheng, R.H.' 9 ? 1 'Greve, J.M.' 10 ? 1 'Mcclelland, A.' 11 ? 1 'Baker, T.S.' 12 ? 1 'Rossmann, M.G.' 13 ? 2 'Greve, J.M.' 14 ? 2 'Davis, G.' 15 ? 2 'Meyer, A.M.' 16 ? 2 'Forte, C.P.' 17 ? 2 'Yost, S.C.' 18 ? 2 'Marlor, C.W.' 19 ? 2 'Kamarck, M.E.' 20 ? 2 'Mcclelland, A.' 21 ? # _cell.entry_id 1IAM _cell.length_a 41.857 _cell.length_b 124.736 _cell.length_c 83.186 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IAM _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'INTERCELLULAR ADHESION MOLECULE-1' 20480.338 1 ? 'N103Q, N118Q, N156Q' 'TWO N-TERMINAL, IMMUNOGLOBULIN DOMAINS' ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 3 water nat water 18.015 147 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ICAM-1, CD54' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFL TVYWTPERVELAPLPSWQPVGKQLTLRCQVEGGAPRAQLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGAQFSCR TELDLRPQGLELFENTSAPYQLQTF ; _entity_poly.pdbx_seq_one_letter_code_can ;QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFL TVYWTPERVELAPLPSWQPVGKQLTLRCQVEGGAPRAQLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGAQFSCR TELDLRPQGLELFENTSAPYQLQTF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 THR n 1 3 SER n 1 4 VAL n 1 5 SER n 1 6 PRO n 1 7 SER n 1 8 LYS n 1 9 VAL n 1 10 ILE n 1 11 LEU n 1 12 PRO n 1 13 ARG n 1 14 GLY n 1 15 GLY n 1 16 SER n 1 17 VAL n 1 18 LEU n 1 19 VAL n 1 20 THR n 1 21 CYS n 1 22 SER n 1 23 THR n 1 24 SER n 1 25 CYS n 1 26 ASP n 1 27 GLN n 1 28 PRO n 1 29 LYS n 1 30 LEU n 1 31 LEU n 1 32 GLY n 1 33 ILE n 1 34 GLU n 1 35 THR n 1 36 PRO n 1 37 LEU n 1 38 PRO n 1 39 LYS n 1 40 LYS n 1 41 GLU n 1 42 LEU n 1 43 LEU n 1 44 LEU n 1 45 PRO n 1 46 GLY n 1 47 ASN n 1 48 ASN n 1 49 ARG n 1 50 LYS n 1 51 VAL n 1 52 TYR n 1 53 GLU n 1 54 LEU n 1 55 SER n 1 56 ASN n 1 57 VAL n 1 58 GLN n 1 59 GLU n 1 60 ASP n 1 61 SER n 1 62 GLN n 1 63 PRO n 1 64 MET n 1 65 CYS n 1 66 TYR n 1 67 SER n 1 68 ASN n 1 69 CYS n 1 70 PRO n 1 71 ASP n 1 72 GLY n 1 73 GLN n 1 74 SER n 1 75 THR n 1 76 ALA n 1 77 LYS n 1 78 THR n 1 79 PHE n 1 80 LEU n 1 81 THR n 1 82 VAL n 1 83 TYR n 1 84 TRP n 1 85 THR n 1 86 PRO n 1 87 GLU n 1 88 ARG n 1 89 VAL n 1 90 GLU n 1 91 LEU n 1 92 ALA n 1 93 PRO n 1 94 LEU n 1 95 PRO n 1 96 SER n 1 97 TRP n 1 98 GLN n 1 99 PRO n 1 100 VAL n 1 101 GLY n 1 102 LYS n 1 103 GLN n 1 104 LEU n 1 105 THR n 1 106 LEU n 1 107 ARG n 1 108 CYS n 1 109 GLN n 1 110 VAL n 1 111 GLU n 1 112 GLY n 1 113 GLY n 1 114 ALA n 1 115 PRO n 1 116 ARG n 1 117 ALA n 1 118 GLN n 1 119 LEU n 1 120 THR n 1 121 VAL n 1 122 VAL n 1 123 LEU n 1 124 LEU n 1 125 ARG n 1 126 GLY n 1 127 GLU n 1 128 LYS n 1 129 GLU n 1 130 LEU n 1 131 LYS n 1 132 ARG n 1 133 GLU n 1 134 PRO n 1 135 ALA n 1 136 VAL n 1 137 GLY n 1 138 GLU n 1 139 PRO n 1 140 ALA n 1 141 GLU n 1 142 VAL n 1 143 THR n 1 144 THR n 1 145 THR n 1 146 VAL n 1 147 LEU n 1 148 VAL n 1 149 ARG n 1 150 ARG n 1 151 ASP n 1 152 HIS n 1 153 HIS n 1 154 GLY n 1 155 ALA n 1 156 GLN n 1 157 PHE n 1 158 SER n 1 159 CYS n 1 160 ARG n 1 161 THR n 1 162 GLU n 1 163 LEU n 1 164 ASP n 1 165 LEU n 1 166 ARG n 1 167 PRO n 1 168 GLN n 1 169 GLY n 1 170 LEU n 1 171 GLU n 1 172 LEU n 1 173 PHE n 1 174 GLU n 1 175 ASN n 1 176 THR n 1 177 SER n 1 178 ALA n 1 179 PRO n 1 180 TYR n 1 181 GLN n 1 182 LEU n 1 183 GLN n 1 184 THR n 1 185 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line SF9 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell 'LEUKOCYTES, ENDOTHELIAL CELLS' _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus Spodoptera _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line SF9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector BACULOVIRUS _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PVL1393 (PHARMINGEN)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ICAM1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P05362 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYE LSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKRE PAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKP EVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDE RDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSPRYE IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IAM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05362 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 212 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 185 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1IAM GLN A 103 ? UNP P05362 ASN 130 'engineered mutation' 103 1 1 1IAM GLN A 118 ? UNP P05362 ASN 145 'engineered mutation' 118 2 1 1IAM GLN A 156 ? UNP P05362 ASN 183 'engineered mutation' 156 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1IAM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_percent_sol 53.56 _exptl_crystal.description ;THERE IS A SIGNIFICANT NUMBER OF OVERLOADS IN THE LOWER RESOLUTION SHELLS (19% BETWEEN 20 AN 5 ANGSTROM). DATA WAS SCALED WITH THE "INCLUDE OVERLOADS" OPTION IN SCALEPACK. LOW RESOLUTION DATA BETWEEN 20 AND 5 ANGSTROM HAS NOT BEEN USED IN THE REFINEMENT. ; # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'PROTEIN IN 10 MM TRIS, PH 7.5, 25 MM NACL, WAS CRYSTALLIZED FROM 20% PEG 4000 IN 10 MM TRIS AS PRECIPITANT' # _diffrn.id 1 _diffrn.ambient_temp 120 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 1995-02-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9200 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE A1' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline A1 _diffrn_source.pdbx_wavelength 0.9200 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1IAM _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.10 _reflns.number_obs 10629 _reflns.number_all ? _reflns.percent_possible_obs 81.1 _reflns.pdbx_Rmerge_I_obs 0.036 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 24.15 _reflns.B_iso_Wilson_estimate 25.1 _reflns.pdbx_redundancy 3.0 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.17 _reflns_shell.percent_possible_all 33.4 _reflns_shell.Rmerge_I_obs 0.059 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 10.21 _reflns_shell.pdbx_redundancy 0.3 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1IAM _refine.ls_number_reflns_obs 9599 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 100000. _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 5.00 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 79.5 _refine.ls_R_factor_obs 0.214 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.214 _refine.ls_R_factor_R_free 0.303 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.1 _refine.ls_number_reflns_R_free 971 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 24.6 _refine.aniso_B[1][1] 3.7699 _refine.aniso_B[2][2] -0.9060 _refine.aniso_B[3][3] -2.8639 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'ICAM-2, PDB ENTRY 1ZXQ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT, MIR, PHASE RECOMBINATION' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1436 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 147 _refine_hist.number_atoms_total 1597 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 5.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.7 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 28.2 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.6 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 1.27 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 1.81 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 2.12 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 2.71 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.19 _refine_ls_shell.number_reflns_R_work 331 _refine_ls_shell.R_factor_R_work 0.219 _refine_ls_shell.percent_reflns_obs 29.0 _refine_ls_shell.R_factor_R_free 0.242 _refine_ls_shell.R_factor_R_free_error 0.037 _refine_ls_shell.percent_reflns_R_free 9.91 _refine_ls_shell.number_reflns_R_free 43 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 PARAM3.CHO TOPH3.CHO 'X-RAY DIFFRACTION' # _struct.entry_id 1IAM _struct.title 'STRUCTURE OF THE TWO AMINO-TERMINAL DOMAINS OF HUMAN INTERCELLULAR ADHESION MOLECULE-1, ICAM-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IAM _struct_keywords.pdbx_keywords 'Viral protein receptor' _struct_keywords.text ;RHINOVIRUS RECEPTOR, CELL ADHESION, INTEGRIN LIGAND, GLYCOPROTEIN, LFA-1 LIGAND, IMMUNOGLOBULIN FOLD, TRANSMEMBRANE, Viral protein receptor ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 116 ? GLN A 118 ? ARG A 116 GLN A 118 5 ? 3 HELX_P HELX_P2 2 ARG A 166 ? GLN A 168 ? ARG A 166 GLN A 168 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 21 A CYS 65 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 69 SG ? ? A CYS 25 A CYS 69 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf3 disulf ? ? A CYS 108 SG ? ? ? 1_555 A CYS 159 SG ? ? A CYS 108 A CYS 159 1_555 ? ? ? ? ? ? ? 2.022 ? ? covale1 covale one ? A ASN 175 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 175 A NAG 275 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 5 A . ? SER 5 A PRO 6 A ? PRO 6 A 1 -0.03 2 ALA 114 A . ? ALA 114 A PRO 115 A ? PRO 115 A 1 0.27 3 GLU 138 A . ? GLU 138 A PRO 139 A ? PRO 139 A 1 -0.56 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 3 ? D ? 3 ? E ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel E 1 2 ? anti-parallel E 2 3 ? anti-parallel E 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 2 ? SER A 5 ? THR A 2 SER A 5 A 2 VAL A 17 ? THR A 23 ? VAL A 17 THR A 23 A 3 ARG A 49 ? SER A 55 ? ARG A 49 SER A 55 A 4 PRO A 38 ? LEU A 42 ? PRO A 38 LEU A 42 B 1 LYS A 8 ? PRO A 12 ? LYS A 8 PRO A 12 B 2 PHE A 79 ? TYR A 83 ? PHE A 79 TYR A 83 C 1 LEU A 30 ? GLU A 34 ? LEU A 30 GLU A 34 C 2 MET A 64 ? ASN A 68 ? MET A 64 ASN A 68 C 3 GLN A 73 ? LYS A 77 ? GLN A 73 LYS A 77 D 1 ARG A 88 ? LEU A 91 ? ARG A 88 LEU A 91 D 2 GLN A 103 ? GLU A 111 ? GLN A 103 GLU A 111 D 3 ALA A 140 ? LEU A 147 ? ALA A 140 LEU A 147 E 1 LEU A 172 ? THR A 176 ? LEU A 172 THR A 176 E 2 PHE A 157 ? ASP A 164 ? PHE A 157 ASP A 164 E 3 LEU A 119 ? ARG A 125 ? LEU A 119 ARG A 125 E 4 LYS A 128 ? PRO A 134 ? LYS A 128 PRO A 134 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 3 ? O SER A 3 N SER A 22 ? N SER A 22 A 2 3 O VAL A 17 ? O VAL A 17 N LEU A 54 ? N LEU A 54 A 3 4 O VAL A 51 ? O VAL A 51 N LEU A 42 ? N LEU A 42 B 1 2 O VAL A 9 ? O VAL A 9 N PHE A 79 ? N PHE A 79 C 1 2 O LEU A 30 ? O LEU A 30 N ASN A 68 ? N ASN A 68 C 2 3 O CYS A 65 ? O CYS A 65 N ALA A 76 ? N ALA A 76 D 1 2 O ARG A 88 ? O ARG A 88 N GLU A 111 ? N GLU A 111 D 2 3 O LEU A 104 ? O LEU A 104 N VAL A 146 ? N VAL A 146 E 1 2 O PHE A 173 ? O PHE A 173 N LEU A 163 ? N LEU A 163 E 2 3 O SER A 158 ? O SER A 158 N LEU A 124 ? N LEU A 124 E 3 4 O VAL A 121 ? O VAL A 121 N GLU A 133 ? N GLU A 133 # _database_PDB_matrix.entry_id 1IAM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IAM _atom_sites.fract_transf_matrix[1][1] 0.023891 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008017 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012021 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 HIS 152 152 152 HIS HIS A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 PHE 185 185 185 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 275 275 NAG NAG A . C 3 HOH 1 400 400 HOH HOH A . C 3 HOH 2 401 401 HOH HOH A . C 3 HOH 3 402 402 HOH HOH A . C 3 HOH 4 403 403 HOH HOH A . C 3 HOH 5 404 404 HOH HOH A . C 3 HOH 6 405 405 HOH HOH A . C 3 HOH 7 406 406 HOH HOH A . C 3 HOH 8 407 407 HOH HOH A . C 3 HOH 9 408 408 HOH HOH A . C 3 HOH 10 409 409 HOH HOH A . C 3 HOH 11 410 410 HOH HOH A . C 3 HOH 12 411 411 HOH HOH A . C 3 HOH 13 412 412 HOH HOH A . C 3 HOH 14 413 413 HOH HOH A . C 3 HOH 15 414 414 HOH HOH A . C 3 HOH 16 415 415 HOH HOH A . C 3 HOH 17 416 416 HOH HOH A . C 3 HOH 18 417 417 HOH HOH A . C 3 HOH 19 418 418 HOH HOH A . C 3 HOH 20 419 419 HOH HOH A . C 3 HOH 21 420 420 HOH HOH A . C 3 HOH 22 421 421 HOH HOH A . C 3 HOH 23 422 422 HOH HOH A . C 3 HOH 24 423 423 HOH HOH A . C 3 HOH 25 424 424 HOH HOH A . C 3 HOH 26 425 425 HOH HOH A . C 3 HOH 27 426 426 HOH HOH A . C 3 HOH 28 427 427 HOH HOH A . C 3 HOH 29 428 428 HOH HOH A . C 3 HOH 30 429 429 HOH HOH A . C 3 HOH 31 430 430 HOH HOH A . C 3 HOH 32 431 431 HOH HOH A . C 3 HOH 33 432 432 HOH HOH A . C 3 HOH 34 433 433 HOH HOH A . C 3 HOH 35 434 434 HOH HOH A . C 3 HOH 36 435 435 HOH HOH A . C 3 HOH 37 436 436 HOH HOH A . C 3 HOH 38 437 437 HOH HOH A . C 3 HOH 39 438 438 HOH HOH A . C 3 HOH 40 439 439 HOH HOH A . C 3 HOH 41 440 440 HOH HOH A . C 3 HOH 42 441 441 HOH HOH A . C 3 HOH 43 442 442 HOH HOH A . C 3 HOH 44 443 443 HOH HOH A . C 3 HOH 45 444 444 HOH HOH A . C 3 HOH 46 445 445 HOH HOH A . C 3 HOH 47 446 446 HOH HOH A . C 3 HOH 48 447 447 HOH HOH A . C 3 HOH 49 448 448 HOH HOH A . C 3 HOH 50 449 449 HOH HOH A . C 3 HOH 51 450 450 HOH HOH A . C 3 HOH 52 451 451 HOH HOH A . C 3 HOH 53 452 452 HOH HOH A . C 3 HOH 54 453 453 HOH HOH A . C 3 HOH 55 454 454 HOH HOH A . C 3 HOH 56 455 455 HOH HOH A . C 3 HOH 57 456 456 HOH HOH A . C 3 HOH 58 457 457 HOH HOH A . C 3 HOH 59 458 458 HOH HOH A . C 3 HOH 60 459 459 HOH HOH A . C 3 HOH 61 460 460 HOH HOH A . C 3 HOH 62 461 461 HOH HOH A . C 3 HOH 63 462 462 HOH HOH A . C 3 HOH 64 463 463 HOH HOH A . C 3 HOH 65 464 464 HOH HOH A . C 3 HOH 66 465 465 HOH HOH A . C 3 HOH 67 466 466 HOH HOH A . C 3 HOH 68 467 467 HOH HOH A . C 3 HOH 69 468 468 HOH HOH A . C 3 HOH 70 469 469 HOH HOH A . C 3 HOH 71 470 470 HOH HOH A . C 3 HOH 72 471 471 HOH HOH A . C 3 HOH 73 472 472 HOH HOH A . C 3 HOH 74 473 473 HOH HOH A . C 3 HOH 75 474 474 HOH HOH A . C 3 HOH 76 475 475 HOH HOH A . C 3 HOH 77 476 476 HOH HOH A . C 3 HOH 78 477 477 HOH HOH A . C 3 HOH 79 478 478 HOH HOH A . C 3 HOH 80 479 479 HOH HOH A . C 3 HOH 81 480 480 HOH HOH A . C 3 HOH 82 481 481 HOH HOH A . C 3 HOH 83 482 482 HOH HOH A . C 3 HOH 84 483 483 HOH HOH A . C 3 HOH 85 484 484 HOH HOH A . C 3 HOH 86 485 485 HOH HOH A . C 3 HOH 87 486 486 HOH HOH A . C 3 HOH 88 487 487 HOH HOH A . C 3 HOH 89 488 488 HOH HOH A . C 3 HOH 90 489 489 HOH HOH A . C 3 HOH 91 490 490 HOH HOH A . C 3 HOH 92 491 491 HOH HOH A . C 3 HOH 93 492 492 HOH HOH A . C 3 HOH 94 493 493 HOH HOH A . C 3 HOH 95 494 494 HOH HOH A . C 3 HOH 96 495 495 HOH HOH A . C 3 HOH 97 496 496 HOH HOH A . C 3 HOH 98 497 497 HOH HOH A . C 3 HOH 99 498 498 HOH HOH A . C 3 HOH 100 499 499 HOH HOH A . C 3 HOH 101 500 500 HOH HOH A . C 3 HOH 102 501 501 HOH HOH A . C 3 HOH 103 502 502 HOH HOH A . C 3 HOH 104 503 503 HOH HOH A . C 3 HOH 105 504 504 HOH HOH A . C 3 HOH 106 505 505 HOH HOH A . C 3 HOH 107 506 506 HOH HOH A . C 3 HOH 108 507 507 HOH HOH A . C 3 HOH 109 508 508 HOH HOH A . C 3 HOH 110 509 509 HOH HOH A . C 3 HOH 111 510 510 HOH HOH A . C 3 HOH 112 511 511 HOH HOH A . C 3 HOH 113 512 512 HOH HOH A . C 3 HOH 114 513 513 HOH HOH A . C 3 HOH 115 514 514 HOH HOH A . C 3 HOH 116 515 515 HOH HOH A . C 3 HOH 117 516 516 HOH HOH A . C 3 HOH 118 517 517 HOH HOH A . C 3 HOH 119 518 518 HOH HOH A . C 3 HOH 120 519 519 HOH HOH A . C 3 HOH 121 520 520 HOH HOH A . C 3 HOH 122 521 521 HOH HOH A . C 3 HOH 123 522 522 HOH HOH A . C 3 HOH 124 523 523 HOH HOH A . C 3 HOH 125 524 524 HOH HOH A . C 3 HOH 126 525 525 HOH HOH A . C 3 HOH 127 526 526 HOH HOH A . C 3 HOH 128 527 527 HOH HOH A . C 3 HOH 129 528 528 HOH HOH A . C 3 HOH 130 529 529 HOH HOH A . C 3 HOH 131 530 530 HOH HOH A . C 3 HOH 132 531 531 HOH HOH A . C 3 HOH 133 532 532 HOH HOH A . C 3 HOH 134 533 533 HOH HOH A . C 3 HOH 135 534 534 HOH HOH A . C 3 HOH 136 535 535 HOH HOH A . C 3 HOH 137 536 536 HOH HOH A . C 3 HOH 138 537 537 HOH HOH A . C 3 HOH 139 538 538 HOH HOH A . C 3 HOH 140 539 539 HOH HOH A . C 3 HOH 141 540 540 HOH HOH A . C 3 HOH 142 541 541 HOH HOH A . C 3 HOH 143 542 542 HOH HOH A . C 3 HOH 144 543 543 HOH HOH A . C 3 HOH 145 544 544 HOH HOH A . C 3 HOH 146 545 545 HOH HOH A . C 3 HOH 147 546 546 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ASN _pdbx_struct_mod_residue.label_seq_id 175 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ASN _pdbx_struct_mod_residue.auth_seq_id 175 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASN _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 124.7360000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 514 ? C HOH . 2 1 A HOH 515 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-29 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-11-16 5 'Structure model' 1 4 2020-07-29 6 'Structure model' 1 5 2021-11-03 7 'Structure model' 1 6 2023-08-09 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Atomic model' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Structure summary' 8 6 'Structure model' 'Database references' 9 6 'Structure model' 'Structure summary' 10 7 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' chem_comp 2 5 'Structure model' entity 3 5 'Structure model' pdbx_chem_comp_identifier 4 5 'Structure model' pdbx_entity_nonpoly 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_site 7 5 'Structure model' struct_site_gen 8 6 'Structure model' chem_comp 9 6 'Structure model' database_2 10 6 'Structure model' struct_ref_seq_dif 11 7 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_chem_comp.name' 2 5 'Structure model' '_chem_comp.type' 3 5 'Structure model' '_entity.pdbx_description' 4 5 'Structure model' '_pdbx_entity_nonpoly.name' 5 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 5 'Structure model' '_struct_conn.pdbx_role' 7 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 8 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 9 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 10 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 11 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 12 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 13 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 14 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 15 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 16 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 17 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 18 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 19 6 'Structure model' '_chem_comp.pdbx_synonyms' 20 6 'Structure model' '_database_2.pdbx_DOI' 21 6 'Structure model' '_database_2.pdbx_database_accession' 22 6 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 X-PLOR 'model building' 3.851 ? 3 X-PLOR refinement 3.851 ? 4 X-PLOR phasing 3.851 ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 35 ? ? -172.57 142.84 2 1 LEU A 44 ? ? -117.82 -133.55 3 1 HIS A 153 ? ? -113.52 -98.28 4 1 LEU A 170 ? ? -110.09 -139.61 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ZXQ _pdbx_initial_refinement_model.details 'ICAM-2, PDB ENTRY 1ZXQ' #