data_1IB8 # _entry.id 1IB8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IB8 pdb_00001ib8 10.2210/pdb1ib8/pdb RCSB RCSB013121 ? ? WWPDB D_1000013121 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IB8 _pdbx_database_status.recvd_initial_deposition_date 2001-03-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yu, L.' 1 'Gunasekera, A.H.' 2 'Mack, J.' 3 'Olejniczak, E.T.' 4 'Chovan, L.E.' 5 'Ruan, X.' 6 'Towne, D.L.' 7 'Lerner, C.G.' 8 'Fesik, S.W.' 9 # _citation.id primary _citation.title 'SOLUTION STRUCTURE AND FUNCTION OF A CONSERVED PROTEIN SP14.3 ENCODED BY AN ESSENTIAL STREPTOCOCCUS PNEUMONIAE GENE' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 311 _citation.page_first 593 _citation.page_last 604 _citation.year 2001 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11493012 _citation.pdbx_database_id_DOI 10.1006/jmbi.2001.4894 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, L.' 1 ? primary 'Gunasekera, A.H.' 2 ? primary 'Mack, J.' 3 ? primary 'Olejniczak, E.T.' 4 ? primary 'Chovan, L.E.' 5 ? primary 'Ruan, X.' 6 ? primary 'Towne, D.L.' 7 ? primary 'Lerner, C.G.' 8 ? primary 'Fesik, S.W.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CONSERVED PROTEIN SP14.3' _entity.formula_weight 18192.957 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGVDAIATIVELVREVVEPVIEAPFELVDIEYGKIGSDMILSIFVDKPEGITLNDTADLTEMISPVLDTIKPDPFPEQY FLEITSPGLERPLKTKDAVAGAVGKYIHVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKKTVQIPYSLVSKARLAV KLLE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGVDAIATIVELVREVVEPVIEAPFELVDIEYGKIGSDMILSIFVDKPEGITLNDTADLTEMISPVLDTIKPDPFPEQY FLEITSPGLERPLKTKDAVAGAVGKYIHVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKKTVQIPYSLVSKARLAV KLLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 VAL n 1 5 ASP n 1 6 ALA n 1 7 ILE n 1 8 ALA n 1 9 THR n 1 10 ILE n 1 11 VAL n 1 12 GLU n 1 13 LEU n 1 14 VAL n 1 15 ARG n 1 16 GLU n 1 17 VAL n 1 18 VAL n 1 19 GLU n 1 20 PRO n 1 21 VAL n 1 22 ILE n 1 23 GLU n 1 24 ALA n 1 25 PRO n 1 26 PHE n 1 27 GLU n 1 28 LEU n 1 29 VAL n 1 30 ASP n 1 31 ILE n 1 32 GLU n 1 33 TYR n 1 34 GLY n 1 35 LYS n 1 36 ILE n 1 37 GLY n 1 38 SER n 1 39 ASP n 1 40 MET n 1 41 ILE n 1 42 LEU n 1 43 SER n 1 44 ILE n 1 45 PHE n 1 46 VAL n 1 47 ASP n 1 48 LYS n 1 49 PRO n 1 50 GLU n 1 51 GLY n 1 52 ILE n 1 53 THR n 1 54 LEU n 1 55 ASN n 1 56 ASP n 1 57 THR n 1 58 ALA n 1 59 ASP n 1 60 LEU n 1 61 THR n 1 62 GLU n 1 63 MET n 1 64 ILE n 1 65 SER n 1 66 PRO n 1 67 VAL n 1 68 LEU n 1 69 ASP n 1 70 THR n 1 71 ILE n 1 72 LYS n 1 73 PRO n 1 74 ASP n 1 75 PRO n 1 76 PHE n 1 77 PRO n 1 78 GLU n 1 79 GLN n 1 80 TYR n 1 81 PHE n 1 82 LEU n 1 83 GLU n 1 84 ILE n 1 85 THR n 1 86 SER n 1 87 PRO n 1 88 GLY n 1 89 LEU n 1 90 GLU n 1 91 ARG n 1 92 PRO n 1 93 LEU n 1 94 LYS n 1 95 THR n 1 96 LYS n 1 97 ASP n 1 98 ALA n 1 99 VAL n 1 100 ALA n 1 101 GLY n 1 102 ALA n 1 103 VAL n 1 104 GLY n 1 105 LYS n 1 106 TYR n 1 107 ILE n 1 108 HIS n 1 109 VAL n 1 110 GLY n 1 111 LEU n 1 112 TYR n 1 113 GLN n 1 114 ALA n 1 115 ILE n 1 116 ASP n 1 117 LYS n 1 118 GLN n 1 119 LYS n 1 120 VAL n 1 121 PHE n 1 122 GLU n 1 123 GLY n 1 124 THR n 1 125 LEU n 1 126 LEU n 1 127 ALA n 1 128 PHE n 1 129 GLU n 1 130 GLU n 1 131 ASP n 1 132 GLU n 1 133 LEU n 1 134 THR n 1 135 MET n 1 136 GLU n 1 137 TYR n 1 138 MET n 1 139 ASP n 1 140 LYS n 1 141 THR n 1 142 ARG n 1 143 LYS n 1 144 LYS n 1 145 THR n 1 146 VAL n 1 147 GLN n 1 148 ILE n 1 149 PRO n 1 150 TYR n 1 151 SER n 1 152 LEU n 1 153 VAL n 1 154 SER n 1 155 LYS n 1 156 ALA n 1 157 ARG n 1 158 LEU n 1 159 ALA n 1 160 VAL n 1 161 LYS n 1 162 LEU n 1 163 LEU n 1 164 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptococcus _entity_src_gen.pdbx_gene_src_gene 'ESSENTIAL GENE' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1313 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y552_STRPN _struct_ref.pdbx_db_accession Q97S61 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IB8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q97S61 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 159 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 'NOESY, TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1 mM SP14.3 15N-labeled, 15N,13C-labeled, and 15N,13C,2H-labeled with selectively protonated methyl groups. 50 mM BisTris HCl, pH 6.5, 50 mM ammonium sulphate. ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DRX 800 # _pdbx_nmr_refine.entry_id 1IB8 _pdbx_nmr_refine.method 'distance geometry/simulated annealing protocol' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1IB8 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1IB8 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1IB8 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'in-house software' ? 'data analysis' ? 1 'CNX software' '2000 Parallel' 'structure solution' 'Brunger et al.' 2 CNX 2000 refinement BRUNGER 3 # _exptl.entry_id 1IB8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1IB8 _struct.title 'SOLUTION STRUCTURE AND FUNCTION OF A CONSERVED PROTEIN SP14.3 ENCODED BY AN ESSENTIAL STREPTOCOCCUS PNEUMONIAE GENE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1IB8 _struct_keywords.pdbx_keywords 'NUCLEIC ACID BINDING PROTEIN' _struct_keywords.text 'NUCLEIC ACID BINDING PROTEIN, RIBOSOMAL PROTEIN, ESSENTIAL GENE, STRUCTURAL GENOMICS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 5 ? GLU A 19 ? ASP A 5 GLU A 19 1 ? 15 HELX_P HELX_P2 2 THR A 53 ? SER A 65 ? THR A 53 SER A 65 1 ? 13 HELX_P HELX_P3 3 THR A 95 ? VAL A 103 ? THR A 95 VAL A 103 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 24 A . ? ALA 24 A PRO 25 A ? PRO 25 A 1 -0.38 2 LYS 72 A . ? LYS 72 A PRO 73 A ? PRO 73 A 1 -0.02 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 27 ? ILE A 36 ? GLU A 27 ILE A 36 A 2 ASP A 39 ? ASP A 47 ? ASP A 39 ASP A 47 A 3 TYR A 80 ? THR A 85 ? TYR A 80 THR A 85 B 1 LYS A 143 ? ILE A 148 ? LYS A 143 ILE A 148 B 2 GLU A 132 ? MET A 138 ? GLU A 132 MET A 138 B 3 VAL A 120 ? GLU A 129 ? VAL A 120 GLU A 129 B 4 LYS A 105 ? GLY A 110 ? LYS A 105 GLY A 110 B 5 LYS A 155 ? ALA A 159 ? LYS A 155 ALA A 159 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 36 ? N ILE A 36 O ASP A 39 ? O ASP A 39 A 2 3 N LEU A 42 ? N LEU A 42 O PHE A 81 ? O PHE A 81 B 1 2 O ILE A 148 ? O ILE A 148 N LEU A 133 ? N LEU A 133 B 2 3 O MET A 138 ? O MET A 138 N GLU A 122 ? N GLU A 122 B 3 4 N LEU A 125 ? N LEU A 125 O LYS A 105 ? O LYS A 105 B 4 5 O HIS A 108 ? O HIS A 108 N ARG A 157 ? N ARG A 157 # _database_PDB_matrix.entry_id 1IB8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IB8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 GLU 164 164 164 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-03-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -174.12 -175.78 2 1 ASP A 5 ? ? -177.64 130.99 3 1 VAL A 21 ? ? -162.16 -71.49 4 1 ALA A 24 ? ? 58.78 172.57 5 1 SER A 38 ? ? -153.47 41.00 6 1 GLU A 50 ? ? 178.62 88.25 7 1 ILE A 52 ? ? 54.70 172.69 8 1 THR A 53 ? ? 174.41 -174.31 9 1 ASP A 69 ? ? -98.47 31.30 10 1 THR A 70 ? ? -144.43 31.58 11 1 ILE A 71 ? ? -94.04 46.19 12 1 ASP A 74 ? ? 174.69 72.60 13 1 GLU A 78 ? ? 169.47 -44.52 14 1 LEU A 89 ? ? -157.42 -69.43 15 1 GLU A 90 ? ? 170.90 -35.36 16 1 ARG A 91 ? ? -167.34 70.97 17 1 LEU A 93 ? ? -99.82 31.66 18 1 ALA A 102 ? ? -48.08 -79.45 19 1 VAL A 103 ? ? 44.49 96.83 20 1 GLN A 113 ? ? -115.63 -80.94 21 1 ALA A 114 ? ? 170.40 148.01 22 1 ASP A 116 ? ? -147.53 59.61 23 1 PRO A 149 ? ? -58.05 -158.20 24 1 SER A 151 ? ? 155.92 31.25 25 1 LEU A 152 ? ? -142.85 24.20 26 1 LEU A 162 ? ? 59.18 173.97 #