data_1IBD # _entry.id 1IBD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IBD pdb_00001ibd 10.2210/pdb1ibd/pdb RCSB RCSB013124 ? ? WWPDB D_1000013124 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1BZO ;P.leiognathi Cu,Zn SOD wild type ; unspecified PDB 1IB5 'P.leiognathi Cu,Zn SOD W83Y mutation' unspecified PDB 1IBB 'P.leiognathi Cu,Zn SOD W83F mutation' unspecified PDB 1IBF 'P.leiognathi Cu,Zn SOD V29G mutation' unspecified PDB 1IBH 'P.leiognathi Cu,Zn SOD M41I mutation' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IBD _pdbx_database_status.recvd_initial_deposition_date 2001-03-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stroppolo, M.E.' 1 'Pesce, A.' 2 ;D'Orazio, M. ; 3 ;O'Neill, P. ; 4 'Bordo, D.' 5 'Rosano, C.' 6 'Milani, M.' 7 'Battistoni, A.' 8 'Bolognesi, M.' 9 'Desideri, A.' 10 # _citation.id primary _citation.title 'Single mutations at the subunit interface modulate copper reactivity in Photobacterium leiognathi Cu,Zn superoxide dismutase.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 308 _citation.page_first 555 _citation.page_last 563 _citation.year 2001 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11327787 _citation.pdbx_database_id_DOI 10.1006/jmbi.2001.4606 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stroppolo, M.E.' 1 ? primary 'Pesce, A.' 2 ? primary ;D'Orazio, M. ; 3 ? primary ;O'Neill, P. ; 4 ? primary 'Bordo, D.' 5 ? primary 'Rosano, C.' 6 ? primary 'Milani, M.' 7 ? primary 'Battistoni, A.' 8 ? primary 'Bolognesi, M.' 9 ? primary 'Desideri, A.' 10 ? # _cell.entry_id 1IBD _cell.length_a 85.938 _cell.length_b 85.938 _cell.length_c 98.787 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IBD _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CU,ZN SUPEROXIDE DISMUTASE' 15785.800 1 1.15.1.1 V29A ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 4 water nat water 18.015 95 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QDLTVKMTDLQTGKPVGTIELSQNKYGVAFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHG FPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ ; _entity_poly.pdbx_seq_one_letter_code_can ;QDLTVKMTDLQTGKPVGTIELSQNKYGVAFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHG FPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ASP n 1 3 LEU n 1 4 THR n 1 5 VAL n 1 6 LYS n 1 7 MET n 1 8 THR n 1 9 ASP n 1 10 LEU n 1 11 GLN n 1 12 THR n 1 13 GLY n 1 14 LYS n 1 15 PRO n 1 16 VAL n 1 17 GLY n 1 18 THR n 1 19 ILE n 1 20 GLU n 1 21 LEU n 1 22 SER n 1 23 GLN n 1 24 ASN n 1 25 LYS n 1 26 TYR n 1 27 GLY n 1 28 VAL n 1 29 ALA n 1 30 PHE n 1 31 ILE n 1 32 PRO n 1 33 GLU n 1 34 LEU n 1 35 ALA n 1 36 ASP n 1 37 LEU n 1 38 THR n 1 39 PRO n 1 40 GLY n 1 41 MET n 1 42 HIS n 1 43 GLY n 1 44 PHE n 1 45 HIS n 1 46 ILE n 1 47 HIS n 1 48 GLN n 1 49 ASN n 1 50 GLY n 1 51 SER n 1 52 CYS n 1 53 ALA n 1 54 SER n 1 55 SER n 1 56 GLU n 1 57 LYS n 1 58 ASP n 1 59 GLY n 1 60 LYS n 1 61 VAL n 1 62 VAL n 1 63 LEU n 1 64 GLY n 1 65 GLY n 1 66 ALA n 1 67 ALA n 1 68 GLY n 1 69 GLY n 1 70 HIS n 1 71 TYR n 1 72 ASP n 1 73 PRO n 1 74 GLU n 1 75 HIS n 1 76 THR n 1 77 ASN n 1 78 LYS n 1 79 HIS n 1 80 GLY n 1 81 PHE n 1 82 PRO n 1 83 TRP n 1 84 THR n 1 85 ASP n 1 86 ASP n 1 87 ASN n 1 88 HIS n 1 89 LYS n 1 90 GLY n 1 91 ASP n 1 92 LEU n 1 93 PRO n 1 94 ALA n 1 95 LEU n 1 96 PHE n 1 97 VAL n 1 98 SER n 1 99 ALA n 1 100 ASN n 1 101 GLY n 1 102 LEU n 1 103 ALA n 1 104 THR n 1 105 ASN n 1 106 PRO n 1 107 VAL n 1 108 LEU n 1 109 ALA n 1 110 PRO n 1 111 ARG n 1 112 LEU n 1 113 THR n 1 114 LEU n 1 115 LYS n 1 116 GLU n 1 117 LEU n 1 118 LYS n 1 119 GLY n 1 120 HIS n 1 121 ALA n 1 122 ILE n 1 123 MET n 1 124 ILE n 1 125 HIS n 1 126 ALA n 1 127 GLY n 1 128 GLY n 1 129 ASP n 1 130 ASN n 1 131 HIS n 1 132 SER n 1 133 ASP n 1 134 MET n 1 135 PRO n 1 136 LYS n 1 137 ALA n 1 138 LEU n 1 139 GLY n 1 140 GLY n 1 141 GLY n 1 142 GLY n 1 143 ALA n 1 144 ARG n 1 145 VAL n 1 146 ALA n 1 147 CYS n 1 148 GLY n 1 149 VAL n 1 150 ILE n 1 151 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Photobacterium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Photobacterium leiognathi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 658 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SODC_PHOLE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QDLTVKMTDLQTGKPVGTIELSQNKYGVVFTPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHG FPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ ; _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_accession P00446 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IBD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00446 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 173 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1IBD ALA A 29 ? UNP P00446 VAL 51 'engineered mutation' 29 1 1 1IBD ILE A 31 ? UNP P00446 THR 53 conflict 31 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1IBD _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_percent_sol 44.65 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 301 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pdbx_details 'PEG 8k, NaCl, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 301K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1999-07-02 _diffrn_detector.details mirror # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE X11' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, HAMBURG' _diffrn_source.pdbx_synchrotron_beamline X11 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 1IBD _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 15 _reflns.d_resolution_high 2.0 _reflns.number_obs 8606 _reflns.number_all 8606 _reflns.percent_possible_obs 90.5 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value 0.07 _reflns.pdbx_netI_over_sigmaI 21 _reflns.B_iso_Wilson_estimate 30 _reflns.pdbx_redundancy 10.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1IBD _refine.ls_number_reflns_obs 8606 _refine.ls_number_reflns_all 8606 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 15 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 90.5 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.214 _refine.ls_R_factor_R_free 0.269 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 860 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'P.leiognathi Cu,Zn SOD wild type' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1108 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 1205 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 15 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.26 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1IBD _struct.title 'X-RAY 3D STRUCTURE OF P.LEIOGNATHI CU,ZN SOD MUTANT V29A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IBD _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'prokaryotic superoxide dismutase, subunit interaction, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 64 ? GLY A 68 ? GLY A 64 GLY A 68 5 ? 5 HELX_P HELX_P2 2 LEU A 114 ? LYS A 118 ? LEU A 114 LYS A 118 5 ? 5 HELX_P HELX_P3 3 LYS A 136 ? GLY A 141 ? LYS A 136 GLY A 141 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 52 SG ? ? ? 1_555 A CYS 147 SG ? ? A CYS 52 A CYS 147 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc1 metalc ? ? A HIS 45 ND1 ? ? ? 1_555 C CU . CU ? ? A HIS 45 A CU 202 1_555 ? ? ? ? ? ? ? 2.090 ? ? metalc2 metalc ? ? A HIS 47 NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 47 A CU 202 1_555 ? ? ? ? ? ? ? 2.283 ? ? metalc3 metalc ? ? A HIS 70 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 70 A ZN 201 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc4 metalc ? ? A HIS 79 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 79 A ZN 201 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc5 metalc ? ? A HIS 88 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 88 A ZN 201 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc6 metalc ? ? A ASP 91 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 91 A ZN 201 1_555 ? ? ? ? ? ? ? 1.894 ? ? metalc7 metalc ? ? A HIS 125 NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 125 A CU 202 1_555 ? ? ? ? ? ? ? 2.071 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 134 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 134 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 135 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 135 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.24 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 44 ? HIS A 47 ? PHE A 44 HIS A 47 A 2 ALA A 121 ? HIS A 125 ? ALA A 121 HIS A 125 A 3 ARG A 144 ? VAL A 149 ? ARG A 144 VAL A 149 A 4 THR A 4 ? ASP A 9 ? THR A 4 ASP A 9 A 5 PRO A 15 ? ASN A 24 ? PRO A 15 ASN A 24 A 6 GLY A 27 ? LEU A 34 ? GLY A 27 LEU A 34 A 7 VAL A 107 ? ALA A 109 ? VAL A 107 ALA A 109 B 1 GLY A 40 ? HIS A 42 ? GLY A 40 HIS A 42 B 2 LEU A 95 ? VAL A 97 ? LEU A 95 VAL A 97 C 1 SER A 55 ? LYS A 57 ? SER A 55 LYS A 57 C 2 LYS A 60 ? VAL A 62 ? LYS A 60 VAL A 62 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 47 ? N HIS A 47 O ALA A 121 ? O ALA A 121 A 2 3 O ILE A 124 ? O ILE A 124 N VAL A 145 ? N VAL A 145 A 3 4 O CYS A 147 ? O CYS A 147 N THR A 8 ? N THR A 8 A 4 5 O MET A 7 ? O MET A 7 N VAL A 16 ? N VAL A 16 A 5 6 N ASN A 24 ? N ASN A 24 O GLY A 27 ? O GLY A 27 A 6 7 N PHE A 30 ? N PHE A 30 O VAL A 107 ? O VAL A 107 B 1 2 O HIS A 42 ? O HIS A 42 N LEU A 95 ? N LEU A 95 C 1 2 O LYS A 57 ? O LYS A 57 N LYS A 60 ? N LYS A 60 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A CU 202 ? 4 'BINDING SITE FOR RESIDUE CU A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 70 ? HIS A 70 . ? 1_555 ? 2 AC1 4 HIS A 79 ? HIS A 79 . ? 1_555 ? 3 AC1 4 HIS A 88 ? HIS A 88 . ? 1_555 ? 4 AC1 4 ASP A 91 ? ASP A 91 . ? 1_555 ? 5 AC2 4 HIS A 45 ? HIS A 45 . ? 1_555 ? 6 AC2 4 HIS A 47 ? HIS A 47 . ? 1_555 ? 7 AC2 4 HIS A 70 ? HIS A 70 . ? 1_555 ? 8 AC2 4 HIS A 125 ? HIS A 125 . ? 1_555 ? # _database_PDB_matrix.entry_id 1IBD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IBD _atom_sites.fract_transf_matrix[1][1] 0.011636 _atom_sites.fract_transf_matrix[1][2] 0.006718 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013436 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010123 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 CYS 147 147 147 CYS CYS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLN 151 151 151 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN A . C 3 CU 1 202 2 CU CU A . D 4 HOH 1 203 1 HOH WAT A . D 4 HOH 2 204 2 HOH WAT A . D 4 HOH 3 205 3 HOH WAT A . D 4 HOH 4 206 4 HOH WAT A . D 4 HOH 5 207 5 HOH WAT A . D 4 HOH 6 208 6 HOH WAT A . D 4 HOH 7 209 7 HOH WAT A . D 4 HOH 8 210 8 HOH WAT A . D 4 HOH 9 211 9 HOH WAT A . D 4 HOH 10 212 11 HOH WAT A . D 4 HOH 11 213 12 HOH WAT A . D 4 HOH 12 214 13 HOH WAT A . D 4 HOH 13 215 14 HOH WAT A . D 4 HOH 14 216 15 HOH WAT A . D 4 HOH 15 217 16 HOH WAT A . D 4 HOH 16 218 17 HOH WAT A . D 4 HOH 17 219 18 HOH WAT A . D 4 HOH 18 220 19 HOH WAT A . D 4 HOH 19 221 20 HOH WAT A . D 4 HOH 20 222 21 HOH WAT A . D 4 HOH 21 223 31 HOH WAT A . D 4 HOH 22 224 32 HOH WAT A . D 4 HOH 23 225 33 HOH WAT A . D 4 HOH 24 226 36 HOH WAT A . D 4 HOH 25 227 37 HOH WAT A . D 4 HOH 26 228 38 HOH WAT A . D 4 HOH 27 229 40 HOH WAT A . D 4 HOH 28 230 41 HOH WAT A . D 4 HOH 29 231 42 HOH WAT A . D 4 HOH 30 232 43 HOH WAT A . D 4 HOH 31 233 45 HOH WAT A . D 4 HOH 32 234 47 HOH WAT A . D 4 HOH 33 235 49 HOH WAT A . D 4 HOH 34 236 50 HOH WAT A . D 4 HOH 35 237 51 HOH WAT A . D 4 HOH 36 238 54 HOH WAT A . D 4 HOH 37 239 55 HOH WAT A . D 4 HOH 38 240 56 HOH WAT A . D 4 HOH 39 241 58 HOH WAT A . D 4 HOH 40 242 60 HOH WAT A . D 4 HOH 41 243 61 HOH WAT A . D 4 HOH 42 244 65 HOH WAT A . D 4 HOH 43 245 66 HOH WAT A . D 4 HOH 44 246 69 HOH WAT A . D 4 HOH 45 247 71 HOH WAT A . D 4 HOH 46 248 75 HOH WAT A . D 4 HOH 47 249 76 HOH WAT A . D 4 HOH 48 250 77 HOH WAT A . D 4 HOH 49 251 78 HOH WAT A . D 4 HOH 50 252 79 HOH WAT A . D 4 HOH 51 253 81 HOH WAT A . D 4 HOH 52 254 85 HOH WAT A . D 4 HOH 53 255 87 HOH WAT A . D 4 HOH 54 256 88 HOH WAT A . D 4 HOH 55 257 89 HOH WAT A . D 4 HOH 56 258 90 HOH WAT A . D 4 HOH 57 259 91 HOH WAT A . D 4 HOH 58 260 92 HOH WAT A . D 4 HOH 59 261 93 HOH WAT A . D 4 HOH 60 262 94 HOH WAT A . D 4 HOH 61 263 95 HOH WAT A . D 4 HOH 62 264 96 HOH WAT A . D 4 HOH 63 265 97 HOH WAT A . D 4 HOH 64 266 98 HOH WAT A . D 4 HOH 65 267 99 HOH WAT A . D 4 HOH 66 268 100 HOH WAT A . D 4 HOH 67 269 101 HOH WAT A . D 4 HOH 68 270 102 HOH WAT A . D 4 HOH 69 271 104 HOH WAT A . D 4 HOH 70 272 105 HOH WAT A . D 4 HOH 71 273 106 HOH WAT A . D 4 HOH 72 274 107 HOH WAT A . D 4 HOH 73 275 108 HOH WAT A . D 4 HOH 74 276 109 HOH WAT A . D 4 HOH 75 277 110 HOH WAT A . D 4 HOH 76 278 112 HOH WAT A . D 4 HOH 77 279 113 HOH WAT A . D 4 HOH 78 280 115 HOH WAT A . D 4 HOH 79 281 116 HOH WAT A . D 4 HOH 80 282 117 HOH WAT A . D 4 HOH 81 283 120 HOH WAT A . D 4 HOH 82 284 121 HOH WAT A . D 4 HOH 83 285 123 HOH WAT A . D 4 HOH 84 286 124 HOH WAT A . D 4 HOH 85 287 125 HOH WAT A . D 4 HOH 86 288 129 HOH WAT A . D 4 HOH 87 289 130 HOH WAT A . D 4 HOH 88 290 133 HOH WAT A . D 4 HOH 89 291 135 HOH WAT A . D 4 HOH 90 292 136 HOH WAT A . D 4 HOH 91 293 139 HOH WAT A . D 4 HOH 92 294 140 HOH WAT A . D 4 HOH 93 295 142 HOH WAT A . D 4 HOH 94 296 143 HOH WAT A . D 4 HOH 95 297 144 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_565 x-y+2/3,-y+4/3,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 99.2326548672 0.0000000000 0.0000000000 -1.0000000000 32.9290000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 239 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 NE2 ? A HIS 47 ? A HIS 47 ? 1_555 143.5 ? 2 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 NE2 ? A HIS 125 ? A HIS 125 ? 1_555 102.3 ? 3 NE2 ? A HIS 47 ? A HIS 47 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 NE2 ? A HIS 125 ? A HIS 125 ? 1_555 114.3 ? 4 ND1 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 79 ? A HIS 79 ? 1_555 102.9 ? 5 ND1 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 88 ? A HIS 88 ? 1_555 100.2 ? 6 ND1 ? A HIS 79 ? A HIS 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 88 ? A HIS 88 ? 1_555 122.4 ? 7 ND1 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 112.4 ? 8 ND1 ? A HIS 79 ? A HIS 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 99.7 ? 9 ND1 ? A HIS 88 ? A HIS 88 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 118.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-05-09 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' diffrn_source 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.value' 20 4 'Structure model' '_struct_conn.pdbx_dist_value' 21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 33 4 'Structure model' '_struct_ref_seq_dif.details' 34 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 35 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 36 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 CNS refinement . ? 3 CNS phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 3 ? ? 52.55 102.54 2 1 ASP A 86 ? ? -82.46 45.98 3 1 HIS A 88 ? ? -39.39 125.84 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LEU 3 ? N ? A LEU 3 N 2 1 Y 0 A LEU 3 ? CA ? A LEU 3 CA 3 1 Y 0 A LEU 3 ? CB ? A LEU 3 CB 4 1 Y 0 A LEU 3 ? CG ? A LEU 3 CG 5 1 Y 0 A LEU 3 ? CD1 ? A LEU 3 CD1 6 1 Y 0 A LEU 3 ? CD2 ? A LEU 3 CD2 7 1 Y 0 A LYS 6 ? CE ? A LYS 6 CE 8 1 Y 0 A LYS 6 ? NZ ? A LYS 6 NZ 9 1 Y 0 A GLN 11 ? CD ? A GLN 11 CD 10 1 Y 0 A GLN 11 ? OE1 ? A GLN 11 OE1 11 1 Y 0 A GLN 11 ? NE2 ? A GLN 11 NE2 12 1 Y 0 A LYS 14 ? CB ? A LYS 14 CB 13 1 Y 0 A LYS 14 ? CG ? A LYS 14 CG 14 1 Y 0 A LYS 14 ? CD ? A LYS 14 CD 15 1 Y 0 A LYS 14 ? CE ? A LYS 14 CE 16 1 Y 0 A LYS 14 ? NZ ? A LYS 14 NZ 17 1 Y 0 A LYS 57 ? CB ? A LYS 57 CB 18 1 Y 0 A LYS 57 ? CG ? A LYS 57 CG 19 1 Y 0 A LYS 57 ? CD ? A LYS 57 CD 20 1 Y 0 A LYS 57 ? CE ? A LYS 57 CE 21 1 Y 0 A LYS 57 ? NZ ? A LYS 57 NZ 22 1 Y 0 A LYS 60 ? CG ? A LYS 60 CG 23 1 Y 0 A LYS 60 ? CD ? A LYS 60 CD 24 1 Y 0 A LYS 60 ? CE ? A LYS 60 CE 25 1 Y 0 A LYS 60 ? NZ ? A LYS 60 NZ 26 1 Y 0 A ASN 77 ? CG ? A ASN 77 CG 27 1 Y 0 A ASN 77 ? OD1 ? A ASN 77 OD1 28 1 Y 0 A ASN 77 ? ND2 ? A ASN 77 ND2 29 1 Y 0 A LYS 115 ? CD ? A LYS 115 CD 30 1 Y 0 A LYS 115 ? CE ? A LYS 115 CE 31 1 Y 0 A LYS 115 ? NZ ? A LYS 115 NZ 32 1 Y 0 A LYS 118 ? CE ? A LYS 118 CE 33 1 Y 0 A LYS 118 ? NZ ? A LYS 118 NZ 34 1 Y 0 A LYS 136 ? CE ? A LYS 136 CE 35 1 Y 0 A LYS 136 ? NZ ? A LYS 136 NZ 36 1 Y 0 A GLN 151 ? CB ? A GLN 151 CB 37 1 Y 0 A GLN 151 ? CG ? A GLN 151 CG 38 1 Y 0 A GLN 151 ? CD ? A GLN 151 CD 39 1 Y 0 A GLN 151 ? OE1 ? A GLN 151 OE1 40 1 Y 0 A GLN 151 ? NE2 ? A GLN 151 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 0 A GLN 1 ? A GLN 1 2 1 Y 0 A ASP 2 ? A ASP 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'COPPER (II) ION' CU 4 water HOH #