data_1IDC # _entry.id 1IDC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IDC pdb_00001idc 10.2210/pdb1idc/pdb WWPDB D_1000174108 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IDC _pdbx_database_status.recvd_initial_deposition_date 1995-01-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bolduc, J.M.' 1 'Dyer, D.H.' 2 'Scott, W.G.' 3 'Singer, P.' 4 'Sweet, R.M.' 5 'Koshland Junior, D.E.' 6 'Stoddard, B.L.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Mutagenesis and Laue structures of enzyme intermediates: isocitrate dehydrogenase.' Science 268 1312 1318 1995 SCIEAS US 0036-8075 0038 ? 7761851 ? 1 ;Catalytic Mechanism of Nadp+-Dependent Isocitrate Dehydrogenase: Implications from the Structures of Magnesium-Isocitrate and Nadp+ Complexes ; Biochemistry 30 8671 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 2 'Regulation of Isocitrate Dehydrogenase by Phosphorylation Involves No Long-Range Conformational Change in the Free Enzyme' J.Biol.Chem. 265 3599 ? 1990 JBCHA3 US 0021-9258 0071 ? ? ? 3 'Regulation of an Enzyme by Phosphorylation at the Active Site' Science 249 1012 ? 1990 SCIEAS US 0036-8075 0038 ? ? ? 4 'Structure of a Bacterial Enzyme Regulated by Phosphorylation, Isocitrate Dehydrogenase' Proc.Natl.Acad.Sci.USA 86 8635 ? 1989 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bolduc, J.M.' 1 ? primary 'Dyer, D.H.' 2 ? primary 'Scott, W.G.' 3 ? primary 'Singer, P.' 4 ? primary 'Sweet, R.M.' 5 ? primary 'Koshland Jr., D.E.' 6 ? primary 'Stoddard, B.L.' 7 ? 1 'Hurley, J.H.' 8 ? 1 'Dean, A.M.' 9 ? 1 'Koshland Junior, D.E.' 10 ? 1 'Stroud, R.M.' 11 ? 2 'Hurley, J.H.' 12 ? 2 'Dean, A.M.' 13 ? 2 'Thorsness, P.E.' 14 ? 2 'Koshland Junior, D.E.' 15 ? 2 'Stroud, R.M.' 16 ? 3 'Hurley, J.H.' 17 ? 3 'Dean, A.M.' 18 ? 3 'Sohl, J.L.' 19 ? 3 'Koshland Junior, D.E.' 20 ? 3 'Stroud, R.M.' 21 ? 4 'Hurley, J.H.' 22 ? 4 'Thorsness, P.E.' 23 ? 4 'Ramalingam, V.' 24 ? 4 'Helmers, N.H.' 25 ? 4 'Koshland Junior, D.E.' 26 ? 4 'Stroud, R.M.' 27 ? # _cell.entry_id 1IDC _cell.length_a 105.100 _cell.length_b 105.100 _cell.length_c 150.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1IDC _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ISOCITRATE DEHYDROGENASE' 45811.578 1 1.1.1.42 K230M ? 'RATE-LIMITED ENOLATE INTERMEDIATE' 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn '2-OXALOSUCCINIC ACID' 190.108 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IDH # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGERKISWMEIYTGEKSTQVYGQ DVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIY AGIEWKADSADAEKVIKFLREEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHMGNIMKFTEGA FKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIACMNLNGDYISDALAAQVGGI GIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSAEMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMDGA KLLKCSEFGDAIIENM ; _entity_poly.pdbx_seq_one_letter_code_can ;MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGERKISWMEIYTGEKSTQVYGQ DVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIY AGIEWKADSADAEKVIKFLREEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHMGNIMKFTEGA FKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIACMNLNGDYISDALAAQVGGI GIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSAEMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMDGA KLLKCSEFGDAIIENM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 SER n 1 4 LYS n 1 5 VAL n 1 6 VAL n 1 7 VAL n 1 8 PRO n 1 9 ALA n 1 10 GLN n 1 11 GLY n 1 12 LYS n 1 13 LYS n 1 14 ILE n 1 15 THR n 1 16 LEU n 1 17 GLN n 1 18 ASN n 1 19 GLY n 1 20 LYS n 1 21 LEU n 1 22 ASN n 1 23 VAL n 1 24 PRO n 1 25 GLU n 1 26 ASN n 1 27 PRO n 1 28 ILE n 1 29 ILE n 1 30 PRO n 1 31 TYR n 1 32 ILE n 1 33 GLU n 1 34 GLY n 1 35 ASP n 1 36 GLY n 1 37 ILE n 1 38 GLY n 1 39 VAL n 1 40 ASP n 1 41 VAL n 1 42 THR n 1 43 PRO n 1 44 ALA n 1 45 MET n 1 46 LEU n 1 47 LYS n 1 48 VAL n 1 49 VAL n 1 50 ASP n 1 51 ALA n 1 52 ALA n 1 53 VAL n 1 54 GLU n 1 55 LYS n 1 56 ALA n 1 57 TYR n 1 58 LYS n 1 59 GLY n 1 60 GLU n 1 61 ARG n 1 62 LYS n 1 63 ILE n 1 64 SER n 1 65 TRP n 1 66 MET n 1 67 GLU n 1 68 ILE n 1 69 TYR n 1 70 THR n 1 71 GLY n 1 72 GLU n 1 73 LYS n 1 74 SER n 1 75 THR n 1 76 GLN n 1 77 VAL n 1 78 TYR n 1 79 GLY n 1 80 GLN n 1 81 ASP n 1 82 VAL n 1 83 TRP n 1 84 LEU n 1 85 PRO n 1 86 ALA n 1 87 GLU n 1 88 THR n 1 89 LEU n 1 90 ASP n 1 91 LEU n 1 92 ILE n 1 93 ARG n 1 94 GLU n 1 95 TYR n 1 96 ARG n 1 97 VAL n 1 98 ALA n 1 99 ILE n 1 100 LYS n 1 101 GLY n 1 102 PRO n 1 103 LEU n 1 104 THR n 1 105 THR n 1 106 PRO n 1 107 VAL n 1 108 GLY n 1 109 GLY n 1 110 GLY n 1 111 ILE n 1 112 ARG n 1 113 SER n 1 114 LEU n 1 115 ASN n 1 116 VAL n 1 117 ALA n 1 118 LEU n 1 119 ARG n 1 120 GLN n 1 121 GLU n 1 122 LEU n 1 123 ASP n 1 124 LEU n 1 125 TYR n 1 126 ILE n 1 127 CYS n 1 128 LEU n 1 129 ARG n 1 130 PRO n 1 131 VAL n 1 132 ARG n 1 133 TYR n 1 134 TYR n 1 135 GLN n 1 136 GLY n 1 137 THR n 1 138 PRO n 1 139 SER n 1 140 PRO n 1 141 VAL n 1 142 LYS n 1 143 HIS n 1 144 PRO n 1 145 GLU n 1 146 LEU n 1 147 THR n 1 148 ASP n 1 149 MET n 1 150 VAL n 1 151 ILE n 1 152 PHE n 1 153 ARG n 1 154 GLU n 1 155 ASN n 1 156 SER n 1 157 GLU n 1 158 ASP n 1 159 ILE n 1 160 TYR n 1 161 ALA n 1 162 GLY n 1 163 ILE n 1 164 GLU n 1 165 TRP n 1 166 LYS n 1 167 ALA n 1 168 ASP n 1 169 SER n 1 170 ALA n 1 171 ASP n 1 172 ALA n 1 173 GLU n 1 174 LYS n 1 175 VAL n 1 176 ILE n 1 177 LYS n 1 178 PHE n 1 179 LEU n 1 180 ARG n 1 181 GLU n 1 182 GLU n 1 183 MET n 1 184 GLY n 1 185 VAL n 1 186 LYS n 1 187 LYS n 1 188 ILE n 1 189 ARG n 1 190 PHE n 1 191 PRO n 1 192 GLU n 1 193 HIS n 1 194 CYS n 1 195 GLY n 1 196 ILE n 1 197 GLY n 1 198 ILE n 1 199 LYS n 1 200 PRO n 1 201 CYS n 1 202 SER n 1 203 GLU n 1 204 GLU n 1 205 GLY n 1 206 THR n 1 207 LYS n 1 208 ARG n 1 209 LEU n 1 210 VAL n 1 211 ARG n 1 212 ALA n 1 213 ALA n 1 214 ILE n 1 215 GLU n 1 216 TYR n 1 217 ALA n 1 218 ILE n 1 219 ALA n 1 220 ASN n 1 221 ASP n 1 222 ARG n 1 223 ASP n 1 224 SER n 1 225 VAL n 1 226 THR n 1 227 LEU n 1 228 VAL n 1 229 HIS n 1 230 MET n 1 231 GLY n 1 232 ASN n 1 233 ILE n 1 234 MET n 1 235 LYS n 1 236 PHE n 1 237 THR n 1 238 GLU n 1 239 GLY n 1 240 ALA n 1 241 PHE n 1 242 LYS n 1 243 ASP n 1 244 TRP n 1 245 GLY n 1 246 TYR n 1 247 GLN n 1 248 LEU n 1 249 ALA n 1 250 ARG n 1 251 GLU n 1 252 GLU n 1 253 PHE n 1 254 GLY n 1 255 GLY n 1 256 GLU n 1 257 LEU n 1 258 ILE n 1 259 ASP n 1 260 GLY n 1 261 GLY n 1 262 PRO n 1 263 TRP n 1 264 LEU n 1 265 LYS n 1 266 VAL n 1 267 LYS n 1 268 ASN n 1 269 PRO n 1 270 ASN n 1 271 THR n 1 272 GLY n 1 273 LYS n 1 274 GLU n 1 275 ILE n 1 276 VAL n 1 277 ILE n 1 278 LYS n 1 279 ASP n 1 280 VAL n 1 281 ILE n 1 282 ALA n 1 283 ASP n 1 284 ALA n 1 285 PHE n 1 286 LEU n 1 287 GLN n 1 288 GLN n 1 289 ILE n 1 290 LEU n 1 291 LEU n 1 292 ARG n 1 293 PRO n 1 294 ALA n 1 295 GLU n 1 296 TYR n 1 297 ASP n 1 298 VAL n 1 299 ILE n 1 300 ALA n 1 301 CYS n 1 302 MET n 1 303 ASN n 1 304 LEU n 1 305 ASN n 1 306 GLY n 1 307 ASP n 1 308 TYR n 1 309 ILE n 1 310 SER n 1 311 ASP n 1 312 ALA n 1 313 LEU n 1 314 ALA n 1 315 ALA n 1 316 GLN n 1 317 VAL n 1 318 GLY n 1 319 GLY n 1 320 ILE n 1 321 GLY n 1 322 ILE n 1 323 ALA n 1 324 PRO n 1 325 GLY n 1 326 ALA n 1 327 ASN n 1 328 ILE n 1 329 GLY n 1 330 ASP n 1 331 GLU n 1 332 CYS n 1 333 ALA n 1 334 LEU n 1 335 PHE n 1 336 GLU n 1 337 ALA n 1 338 THR n 1 339 HIS n 1 340 GLY n 1 341 THR n 1 342 ALA n 1 343 PRO n 1 344 LYS n 1 345 TYR n 1 346 ALA n 1 347 GLY n 1 348 GLN n 1 349 ASP n 1 350 LYS n 1 351 VAL n 1 352 ASN n 1 353 PRO n 1 354 GLY n 1 355 SER n 1 356 ILE n 1 357 ILE n 1 358 LEU n 1 359 SER n 1 360 ALA n 1 361 GLU n 1 362 MET n 1 363 MET n 1 364 LEU n 1 365 ARG n 1 366 HIS n 1 367 MET n 1 368 GLY n 1 369 TRP n 1 370 THR n 1 371 GLU n 1 372 ALA n 1 373 ALA n 1 374 ASP n 1 375 LEU n 1 376 ILE n 1 377 VAL n 1 378 LYS n 1 379 GLY n 1 380 MET n 1 381 GLU n 1 382 GLY n 1 383 ALA n 1 384 ILE n 1 385 ASN n 1 386 ALA n 1 387 LYS n 1 388 THR n 1 389 VAL n 1 390 THR n 1 391 TYR n 1 392 ASP n 1 393 PHE n 1 394 GLU n 1 395 ARG n 1 396 LEU n 1 397 MET n 1 398 ASP n 1 399 GLY n 1 400 ALA n 1 401 LYS n 1 402 LEU n 1 403 LEU n 1 404 LYS n 1 405 CYS n 1 406 SER n 1 407 GLU n 1 408 PHE n 1 409 GLY n 1 410 ASP n 1 411 ALA n 1 412 ILE n 1 413 ILE n 1 414 GLU n 1 415 ASN n 1 416 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ICD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain JLK1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant 'ICD(-) (DEFICIENT IN WT IDH GENE)' _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'PEMBL (DENTE ET AL 1983 NUC ACIDS RES 11,1645)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ICD _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type BACTERIAL _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PTK513 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IDH_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P08200 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGERKISWMEIYTGEKSTQVYGQ DVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIY AGIEWKADSADAEKVIKFLREEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHKGNIMKFTEGA FKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIACMNLNGDYISDALAAQVGGI GIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSAEMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMDGA KLLKCSEFGDAIIENM ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IDC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 416 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08200 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 416 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 416 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1IDC _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 230 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P08200 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 230 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 230 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 OXS non-polymer . '2-OXALOSUCCINIC ACID' ? 'C6 H6 O7' 190.108 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1IDC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.53 _exptl_crystal.density_percent_sol 72.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type FUJI _diffrn_detector.pdbx_collection_date 1993-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l L _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol LAUE _diffrn_radiation.pdbx_scattering_type neutron # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.7 1.0 2 2.1 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X26C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X26C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.7 - 2.1' # _reflns.entry_id 1IDC _reflns.observed_criterion_sigma_I 1. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 17316 _reflns.number_all ? _reflns.percent_possible_obs 62. _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 18.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1IDC _refine.ls_number_reflns_obs 17316 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 2.5 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.169 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.169 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ;DATA COLLECTED FROM FOUR SEPARATE CRYSTALS AT X26-C (POLYCHROMATIC LAUE BEAM LINE AT BROOKHAVEN NATIONAL LABORATORY) AND MERGED TOGETHER WITH LAUENORM IN OXFORD LAUE DATA REDUCTION PACKAGE. ; _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3195 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3209 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.018 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 3.661 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 25.07 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.839 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1IDC _struct.title 'ISOCITRATE DEHYDROGENASE FROM E.COLI (MUTANT K230M), STEADY-STATE INTERMEDIATE COMPLEX DETERMINED BY LAUE CRYSTALLOGRAPHY' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IDC _struct_keywords.pdbx_keywords 'OXIDOREDUCTASE (NAD(A)-CHOH(D))' _struct_keywords.text 'OXIDOREDUCTASE (NAD(A)-CHOH(D))' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 HA ILE A 37 ? LYS A 58 ? ILE A 37 LYS A 58 1 ? 22 HELX_P HELX_P2 HB THR A 70 ? TYR A 78 ? THR A 70 TYR A 78 1 ? 9 HELX_P HELX_P3 HC PRO A 85 ? TYR A 95 ? PRO A 85 TYR A 95 1 ? 11 HELX_P HELX_P4 HD SER A 113 ? LEU A 124 ? SER A 113 LEU A 124 1 ? 12 HELX_P HELX_P5 HE ASP A 168 ? MET A 183 ? ASP A 168 MET A 183 1 ? 16 HELX_P HELX_P6 HF GLU A 203 ? ARG A 222 ? GLU A 203 ARG A 222 1 ? 20 HELX_P HELX_P7 HG LYS A 235 ? PHE A 253 ? LYS A 235 PHE A 253 1 ? 19 HELX_P HELX_P8 HH ILE A 281 ? LEU A 291 ? ILE A 281 LEU A 291 1 ? 11 HELX_P HELX_P9 HI ASN A 303 ? VAL A 317 ? ASN A 303 VAL A 317 1 ? 15 HELX_P HELX_P10 HJ PRO A 353 ? MET A 367 ? PRO A 353 MET A 367 1 ? 15 HELX_P HELX_P11 HK TRP A 369 ? THR A 388 ? TRP A 369 THR A 388 1 ? 20 HELX_P HELX_P12 HL THR A 390 ? MET A 397 ? THR A 390 MET A 397 1 ? 8 HELX_P HELX_P13 HM LYS A 404 ? ASN A 415 ? LYS A 404 ASN A 415 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A TYR 160 OH ? ? ? 1_555 C OXS . O1 ? ? A TYR 160 A OXS 418 1_555 ? ? ? ? ? ? ? 1.710 ? ? metalc1 metalc ? ? A ASP 283 OD2 ? ? ? 7_555 B MG . MG ? ? A ASP 283 A MG 417 1_555 ? ? ? ? ? ? ? 2.202 ? ? metalc2 metalc ? ? A ASP 307 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 307 A MG 417 1_555 ? ? ? ? ? ? ? 2.008 ? ? metalc3 metalc ? ? A ASP 311 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 311 A MG 417 1_555 ? ? ? ? ? ? ? 3.053 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 C OXS . O7 ? ? A MG 417 A OXS 418 1_555 ? ? ? ? ? ? ? 2.462 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 C OXS . O5 ? ? A MG 417 A OXS 418 1_555 ? ? ? ? ? ? ? 2.246 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 261 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 261 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 262 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 262 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 9.72 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 12 ? S2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? parallel S1 2 3 ? parallel S1 3 4 ? parallel S1 4 5 ? anti-parallel S1 5 6 ? anti-parallel S1 6 7 ? anti-parallel S1 7 8 ? parallel S1 8 9 ? parallel S1 9 10 ? parallel S1 10 11 ? anti-parallel S1 11 12 ? anti-parallel S2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 ARG A 61 ? ILE A 68 ? ARG A 61 ILE A 68 S1 2 GLU A 25 ? ILE A 32 ? GLU A 25 ILE A 32 S1 3 ARG A 96 ? LYS A 100 ? ARG A 96 LYS A 100 S1 4 ALA A 333 ? GLU A 336 ? ALA A 333 GLU A 336 S1 5 GLY A 325 ? ILE A 328 ? GLY A 325 ILE A 328 S1 6 TYR A 125 ? ARG A 132 ? TYR A 125 ARG A 132 S1 7 THR A 147 ? ARG A 153 ? THR A 147 ARG A 153 S1 8 ASP A 297 ? MET A 302 ? ASP A 297 MET A 302 S1 9 SER A 224 ? HIS A 229 ? SER A 224 HIS A 229 S1 10 LYS A 273 ? VAL A 280 ? LYS A 273 VAL A 280 S1 11 LEU A 264 ? LYS A 267 ? LEU A 264 LYS A 267 S1 12 GLY A 254 ? GLU A 256 ? GLY A 254 GLU A 256 S2 1 ILE A 163 ? ALA A 167 ? ILE A 163 ALA A 167 S2 2 HIS A 193 ? SER A 202 ? HIS A 193 SER A 202 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details SUB Author ? ? ? ? 8 'ISOCITRATE/MG++ BINDING SITE' AC1 Software A MG 417 ? 4 'BINDING SITE FOR RESIDUE MG A 417' AC2 Software A OXS 418 ? 10 'BINDING SITE FOR RESIDUE OXS A 418' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 SUB 8 SER A 113 ? SER A 113 . ? 1_555 ? 2 SUB 8 ASN A 115 ? ASN A 115 . ? 1_555 ? 3 SUB 8 ARG A 119 ? ARG A 119 . ? 1_555 ? 4 SUB 8 ARG A 129 ? ARG A 129 . ? 1_555 ? 5 SUB 8 ARG A 153 ? ARG A 153 . ? 1_555 ? 6 SUB 8 TYR A 160 ? TYR A 160 . ? 1_555 ? 7 SUB 8 ASP A 307 ? ASP A 307 . ? 1_555 ? 8 SUB 8 ASP A 311 ? ASP A 311 . ? 1_555 ? 9 AC1 4 ASP A 283 ? ASP A 283 . ? 7_555 ? 10 AC1 4 ASP A 307 ? ASP A 307 . ? 1_555 ? 11 AC1 4 ASP A 311 ? ASP A 311 . ? 1_555 ? 12 AC1 4 OXS C . ? OXS A 418 . ? 1_555 ? 13 AC2 10 SER A 113 ? SER A 113 . ? 1_555 ? 14 AC2 10 ASN A 115 ? ASN A 115 . ? 1_555 ? 15 AC2 10 VAL A 116 ? VAL A 116 . ? 1_555 ? 16 AC2 10 ARG A 119 ? ARG A 119 . ? 1_555 ? 17 AC2 10 ARG A 153 ? ARG A 153 . ? 1_555 ? 18 AC2 10 TYR A 160 ? TYR A 160 . ? 1_555 ? 19 AC2 10 ILE A 233 ? ILE A 233 . ? 7_555 ? 20 AC2 10 ASP A 283 ? ASP A 283 . ? 7_555 ? 21 AC2 10 ASP A 307 ? ASP A 307 . ? 1_555 ? 22 AC2 10 MG B . ? MG A 417 . ? 1_555 ? # _database_PDB_matrix.entry_id 1IDC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IDC _atom_sites.fract_transf_matrix[1][1] 0.009515 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009515 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006653 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'CIS PROLINE - PRO 262' # loop_ _atom_type.symbol C H MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 MET 149 149 149 MET MET A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 TRP 165 165 165 TRP TRP A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 HIS 193 193 193 HIS HIS A . n A 1 194 CYS 194 194 194 CYS CYS A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 CYS 201 201 201 CYS CYS A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 TYR 216 216 216 TYR TYR A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 HIS 229 229 229 HIS HIS A . n A 1 230 MET 230 230 230 MET MET A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 MET 234 234 234 MET MET A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 PHE 241 241 241 PHE PHE A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 TRP 244 244 244 TRP TRP A . n A 1 245 GLY 245 245 245 GLY GLY A . n A 1 246 TYR 246 246 246 TYR TYR A . n A 1 247 GLN 247 247 247 GLN GLN A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 ALA 249 249 249 ALA ALA A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 PHE 253 253 253 PHE PHE A . n A 1 254 GLY 254 254 254 GLY GLY A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 ASP 259 259 259 ASP ASP A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 PRO 262 262 262 PRO PRO A . n A 1 263 TRP 263 263 263 TRP TRP A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 ASN 270 270 270 ASN ASN A . n A 1 271 THR 271 271 271 THR THR A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 LYS 273 273 273 LYS LYS A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 VAL 276 276 276 VAL VAL A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 ASP 279 279 279 ASP ASP A . n A 1 280 VAL 280 280 280 VAL VAL A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 PHE 285 285 285 PHE PHE A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 GLN 287 287 287 GLN GLN A . n A 1 288 GLN 288 288 288 GLN GLN A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 ARG 292 292 292 ARG ARG A . n A 1 293 PRO 293 293 293 PRO PRO A . n A 1 294 ALA 294 294 294 ALA ALA A . n A 1 295 GLU 295 295 295 GLU GLU A . n A 1 296 TYR 296 296 296 TYR TYR A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 VAL 298 298 298 VAL VAL A . n A 1 299 ILE 299 299 299 ILE ILE A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 CYS 301 301 301 CYS CYS A . n A 1 302 MET 302 302 302 MET MET A . n A 1 303 ASN 303 303 303 ASN ASN A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 ASN 305 305 305 ASN ASN A . n A 1 306 GLY 306 306 306 GLY GLY A . n A 1 307 ASP 307 307 307 ASP ASP A . n A 1 308 TYR 308 308 308 TYR TYR A . n A 1 309 ILE 309 309 309 ILE ILE A . n A 1 310 SER 310 310 310 SER SER A . n A 1 311 ASP 311 311 311 ASP ASP A . n A 1 312 ALA 312 312 312 ALA ALA A . n A 1 313 LEU 313 313 313 LEU LEU A . n A 1 314 ALA 314 314 314 ALA ALA A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 GLN 316 316 316 GLN GLN A . n A 1 317 VAL 317 317 317 VAL VAL A . n A 1 318 GLY 318 318 318 GLY GLY A . n A 1 319 GLY 319 319 319 GLY GLY A . n A 1 320 ILE 320 320 320 ILE ILE A . n A 1 321 GLY 321 321 321 GLY GLY A . n A 1 322 ILE 322 322 322 ILE ILE A . n A 1 323 ALA 323 323 323 ALA ALA A . n A 1 324 PRO 324 324 324 PRO PRO A . n A 1 325 GLY 325 325 325 GLY GLY A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 ASN 327 327 327 ASN ASN A . n A 1 328 ILE 328 328 328 ILE ILE A . n A 1 329 GLY 329 329 329 GLY GLY A . n A 1 330 ASP 330 330 330 ASP ASP A . n A 1 331 GLU 331 331 331 GLU GLU A . n A 1 332 CYS 332 332 332 CYS CYS A . n A 1 333 ALA 333 333 333 ALA ALA A . n A 1 334 LEU 334 334 334 LEU LEU A . n A 1 335 PHE 335 335 335 PHE PHE A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 ALA 337 337 337 ALA ALA A . n A 1 338 THR 338 338 338 THR THR A . n A 1 339 HIS 339 339 339 HIS HIS A . n A 1 340 GLY 340 340 340 GLY GLY A . n A 1 341 THR 341 341 341 THR THR A . n A 1 342 ALA 342 342 342 ALA ALA A . n A 1 343 PRO 343 343 343 PRO PRO A . n A 1 344 LYS 344 344 344 LYS LYS A . n A 1 345 TYR 345 345 345 TYR TYR A . n A 1 346 ALA 346 346 346 ALA ALA A . n A 1 347 GLY 347 347 347 GLY GLY A . n A 1 348 GLN 348 348 348 GLN GLN A . n A 1 349 ASP 349 349 349 ASP ASP A . n A 1 350 LYS 350 350 350 LYS LYS A . n A 1 351 VAL 351 351 351 VAL VAL A . n A 1 352 ASN 352 352 352 ASN ASN A . n A 1 353 PRO 353 353 353 PRO PRO A . n A 1 354 GLY 354 354 354 GLY GLY A . n A 1 355 SER 355 355 355 SER SER A . n A 1 356 ILE 356 356 356 ILE ILE A . n A 1 357 ILE 357 357 357 ILE ILE A . n A 1 358 LEU 358 358 358 LEU LEU A . n A 1 359 SER 359 359 359 SER SER A . n A 1 360 ALA 360 360 360 ALA ALA A . n A 1 361 GLU 361 361 361 GLU GLU A . n A 1 362 MET 362 362 362 MET MET A . n A 1 363 MET 363 363 363 MET MET A . n A 1 364 LEU 364 364 364 LEU LEU A . n A 1 365 ARG 365 365 365 ARG ARG A . n A 1 366 HIS 366 366 366 HIS HIS A . n A 1 367 MET 367 367 367 MET MET A . n A 1 368 GLY 368 368 368 GLY GLY A . n A 1 369 TRP 369 369 369 TRP TRP A . n A 1 370 THR 370 370 370 THR THR A . n A 1 371 GLU 371 371 371 GLU GLU A . n A 1 372 ALA 372 372 372 ALA ALA A . n A 1 373 ALA 373 373 373 ALA ALA A . n A 1 374 ASP 374 374 374 ASP ASP A . n A 1 375 LEU 375 375 375 LEU LEU A . n A 1 376 ILE 376 376 376 ILE ILE A . n A 1 377 VAL 377 377 377 VAL VAL A . n A 1 378 LYS 378 378 378 LYS LYS A . n A 1 379 GLY 379 379 379 GLY GLY A . n A 1 380 MET 380 380 380 MET MET A . n A 1 381 GLU 381 381 381 GLU GLU A . n A 1 382 GLY 382 382 382 GLY GLY A . n A 1 383 ALA 383 383 383 ALA ALA A . n A 1 384 ILE 384 384 384 ILE ILE A . n A 1 385 ASN 385 385 385 ASN ASN A . n A 1 386 ALA 386 386 386 ALA ALA A . n A 1 387 LYS 387 387 387 LYS LYS A . n A 1 388 THR 388 388 388 THR THR A . n A 1 389 VAL 389 389 389 VAL VAL A . n A 1 390 THR 390 390 390 THR THR A . n A 1 391 TYR 391 391 391 TYR TYR A . n A 1 392 ASP 392 392 392 ASP ASP A . n A 1 393 PHE 393 393 393 PHE PHE A . n A 1 394 GLU 394 394 394 GLU GLU A . n A 1 395 ARG 395 395 395 ARG ARG A . n A 1 396 LEU 396 396 396 LEU LEU A . n A 1 397 MET 397 397 397 MET MET A . n A 1 398 ASP 398 398 398 ASP ASP A . n A 1 399 GLY 399 399 399 GLY GLY A . n A 1 400 ALA 400 400 400 ALA ALA A . n A 1 401 LYS 401 401 401 LYS LYS A . n A 1 402 LEU 402 402 402 LEU LEU A . n A 1 403 LEU 403 403 403 LEU LEU A . n A 1 404 LYS 404 404 404 LYS LYS A . n A 1 405 CYS 405 405 405 CYS CYS A . n A 1 406 SER 406 406 406 SER SER A . n A 1 407 GLU 407 407 407 GLU GLU A . n A 1 408 PHE 408 408 408 PHE PHE A . n A 1 409 GLY 409 409 409 GLY GLY A . n A 1 410 ASP 410 410 410 ASP ASP A . n A 1 411 ALA 411 411 411 ALA ALA A . n A 1 412 ILE 412 412 412 ILE ILE A . n A 1 413 ILE 413 413 413 ILE ILE A . n A 1 414 GLU 414 414 414 GLU GLU A . n A 1 415 ASN 415 415 415 ASN ASN A . n A 1 416 MET 416 416 416 MET MET A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 417 1 MG MG A . C 3 OXS 1 418 1 OXS OXS A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7860 ? 1 MORE -59 ? 1 'SSA (A^2)' 31040 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 283 ? A ASP 283 ? 7_555 MG ? B MG . ? A MG 417 ? 1_555 OD1 ? A ASP 307 ? A ASP 307 ? 1_555 86.1 ? 2 OD2 ? A ASP 283 ? A ASP 283 ? 7_555 MG ? B MG . ? A MG 417 ? 1_555 OD2 ? A ASP 311 ? A ASP 311 ? 1_555 74.3 ? 3 OD1 ? A ASP 307 ? A ASP 307 ? 1_555 MG ? B MG . ? A MG 417 ? 1_555 OD2 ? A ASP 311 ? A ASP 311 ? 1_555 115.1 ? 4 OD2 ? A ASP 283 ? A ASP 283 ? 7_555 MG ? B MG . ? A MG 417 ? 1_555 O7 ? C OXS . ? A OXS 418 ? 1_555 147.5 ? 5 OD1 ? A ASP 307 ? A ASP 307 ? 1_555 MG ? B MG . ? A MG 417 ? 1_555 O7 ? C OXS . ? A OXS 418 ? 1_555 88.4 ? 6 OD2 ? A ASP 311 ? A ASP 311 ? 1_555 MG ? B MG . ? A MG 417 ? 1_555 O7 ? C OXS . ? A OXS 418 ? 1_555 136.1 ? 7 OD2 ? A ASP 283 ? A ASP 283 ? 7_555 MG ? B MG . ? A MG 417 ? 1_555 O5 ? C OXS . ? A OXS 418 ? 1_555 83.7 ? 8 OD1 ? A ASP 307 ? A ASP 307 ? 1_555 MG ? B MG . ? A MG 417 ? 1_555 O5 ? C OXS . ? A OXS 418 ? 1_555 119.2 ? 9 OD2 ? A ASP 311 ? A ASP 311 ? 1_555 MG ? B MG . ? A MG 417 ? 1_555 O5 ? C OXS . ? A OXS 418 ? 1_555 119.0 ? 10 O7 ? C OXS . ? A OXS 418 ? 1_555 MG ? B MG . ? A MG 417 ? 1_555 O5 ? C OXS . ? A OXS 418 ? 1_555 71.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-03-08 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' Advisory 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 3 4 'Structure model' struct_conf 4 4 'Structure model' struct_conf_type 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_struct_conn_angle 7 5 'Structure model' pdbx_unobs_or_zero_occ_atoms 8 5 'Structure model' struct_conn 9 5 'Structure model' struct_ref_seq_dif 10 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 18 5 'Structure model' '_pdbx_struct_conn_angle.value' 19 5 'Structure model' '_struct_conn.pdbx_dist_value' 20 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 21 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 5 'Structure model' '_struct_conn.ptnr1_symmetry' 28 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 34 5 'Structure model' '_struct_conn.ptnr2_symmetry' 35 5 'Structure model' '_struct_ref_seq_dif.details' 36 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 37 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 38 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 OXFORD 'data reduction' 'LAUE PACKAGE (J.CAMPBELL)' ? 3 X-PLOR phasing 3.1 ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OH _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 160 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 C1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 OXS _pdbx_validate_close_contact.auth_seq_id_2 418 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 143 ? ? CD2 A HIS 143 ? ? 1.300 1.373 -0.073 0.011 N 2 1 NE2 A HIS 193 ? ? CD2 A HIS 193 ? ? 1.297 1.373 -0.076 0.011 N 3 1 NE2 A HIS 229 ? ? CD2 A HIS 229 ? ? 1.294 1.373 -0.079 0.011 N 4 1 NE2 A HIS 366 ? ? CD2 A HIS 366 ? ? 1.304 1.373 -0.069 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 57 ? ? CG A TYR 57 ? ? CD1 A TYR 57 ? ? 116.63 121.00 -4.37 0.60 N 2 1 NE A ARG 61 ? ? CZ A ARG 61 ? ? NH1 A ARG 61 ? ? 124.89 120.30 4.59 0.50 N 3 1 CE2 A TRP 65 ? ? CD2 A TRP 65 ? ? CG A TRP 65 ? ? 101.83 107.30 -5.47 0.80 N 4 1 CG A TRP 65 ? ? CD2 A TRP 65 ? ? CE3 A TRP 65 ? ? 140.08 133.90 6.18 0.90 N 5 1 CA A TYR 69 ? ? C A TYR 69 ? ? N A THR 70 ? ? 103.20 117.20 -14.00 2.20 Y 6 1 O A TYR 69 ? ? C A TYR 69 ? ? N A THR 70 ? ? 132.55 122.70 9.85 1.60 Y 7 1 CD1 A TRP 83 ? ? CG A TRP 83 ? ? CD2 A TRP 83 ? ? 114.13 106.30 7.83 0.80 N 8 1 CB A TRP 83 ? ? CG A TRP 83 ? ? CD1 A TRP 83 ? ? 118.93 127.00 -8.07 1.30 N 9 1 CG A TRP 83 ? ? CD1 A TRP 83 ? ? NE1 A TRP 83 ? ? 104.04 110.10 -6.06 1.00 N 10 1 CE2 A TRP 83 ? ? CD2 A TRP 83 ? ? CG A TRP 83 ? ? 100.66 107.30 -6.64 0.80 N 11 1 CG A TRP 83 ? ? CD2 A TRP 83 ? ? CE3 A TRP 83 ? ? 139.74 133.90 5.84 0.90 N 12 1 CA A TYR 95 ? ? CB A TYR 95 ? ? CG A TYR 95 ? ? 101.96 113.40 -11.44 1.90 N 13 1 NE A ARG 112 ? ? CZ A ARG 112 ? ? NH1 A ARG 112 ? ? 125.00 120.30 4.70 0.50 N 14 1 NE A ARG 112 ? ? CZ A ARG 112 ? ? NH2 A ARG 112 ? ? 116.14 120.30 -4.16 0.50 N 15 1 NE A ARG 119 ? ? CZ A ARG 119 ? ? NH1 A ARG 119 ? ? 127.15 120.30 6.85 0.50 N 16 1 NE A ARG 119 ? ? CZ A ARG 119 ? ? NH2 A ARG 119 ? ? 115.66 120.30 -4.64 0.50 N 17 1 N A VAL 141 ? ? CA A VAL 141 ? ? CB A VAL 141 ? ? 97.42 111.50 -14.08 2.20 N 18 1 NE A ARG 153 ? ? CZ A ARG 153 ? ? NH2 A ARG 153 ? ? 117.25 120.30 -3.05 0.50 N 19 1 CD1 A TRP 165 ? ? CG A TRP 165 ? ? CD2 A TRP 165 ? ? 113.55 106.30 7.25 0.80 N 20 1 CE2 A TRP 165 ? ? CD2 A TRP 165 ? ? CG A TRP 165 ? ? 100.99 107.30 -6.31 0.80 N 21 1 CA A CYS 194 ? ? CB A CYS 194 ? ? SG A CYS 194 ? ? 120.81 114.20 6.61 1.10 N 22 1 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.73 120.30 3.43 0.50 N 23 1 CG A MET 230 ? ? SD A MET 230 ? ? CE A MET 230 ? ? 112.44 100.20 12.24 1.60 N 24 1 CD1 A TRP 244 ? ? CG A TRP 244 ? ? CD2 A TRP 244 ? ? 112.06 106.30 5.76 0.80 N 25 1 CE2 A TRP 244 ? ? CD2 A TRP 244 ? ? CG A TRP 244 ? ? 101.14 107.30 -6.16 0.80 N 26 1 CG A TRP 244 ? ? CD2 A TRP 244 ? ? CE3 A TRP 244 ? ? 139.56 133.90 5.66 0.90 N 27 1 NE A ARG 250 ? ? CZ A ARG 250 ? ? NH2 A ARG 250 ? ? 116.35 120.30 -3.95 0.50 N 28 1 CA A ASP 259 ? ? C A ASP 259 ? ? N A GLY 260 ? ? 128.81 116.20 12.61 2.00 Y 29 1 CA A LEU 286 ? ? CB A LEU 286 ? ? CG A LEU 286 ? ? 131.33 115.30 16.03 2.30 N 30 1 CG1 A ILE 299 ? ? CB A ILE 299 ? ? CG2 A ILE 299 ? ? 97.70 111.40 -13.70 2.20 N 31 1 CD1 A TRP 369 ? ? CG A TRP 369 ? ? CD2 A TRP 369 ? ? 111.74 106.30 5.44 0.80 N 32 1 CE2 A TRP 369 ? ? CD2 A TRP 369 ? ? CG A TRP 369 ? ? 102.31 107.30 -4.99 0.80 N 33 1 CB A VAL 389 ? ? CA A VAL 389 ? ? C A VAL 389 ? ? 123.14 111.40 11.74 1.90 N 34 1 N A VAL 389 ? ? CA A VAL 389 ? ? CB A VAL 389 ? ? 92.25 111.50 -19.25 2.20 N 35 1 CG1 A VAL 389 ? ? CB A VAL 389 ? ? CG2 A VAL 389 ? ? 122.87 110.90 11.97 1.60 N 36 1 NE A ARG 395 ? ? CZ A ARG 395 ? ? NH1 A ARG 395 ? ? 123.59 120.30 3.29 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 18 ? ? 23.34 73.13 2 1 LYS A 55 ? ? -64.32 -71.27 3 1 TYR A 78 ? ? -95.38 -65.86 4 1 GLN A 80 ? ? -69.35 4.12 5 1 ARG A 96 ? ? 71.54 -36.10 6 1 VAL A 131 ? ? -167.77 103.08 7 1 PHE A 152 ? ? -114.23 77.18 8 1 ASP A 158 ? ? 71.35 170.12 9 1 GLU A 181 ? ? -77.41 -76.73 10 1 MET A 230 ? ? -100.27 54.23 11 1 ILE A 233 ? ? -126.15 -50.99 12 1 THR A 237 ? ? -118.52 -89.88 13 1 ASP A 259 ? ? 42.81 -82.91 14 1 ALA A 282 ? ? -26.73 -56.95 15 1 ASP A 297 ? ? -140.84 -94.92 16 1 VAL A 389 ? ? -128.52 -166.96 17 1 TYR A 391 ? ? -39.41 -31.90 18 1 ARG A 395 ? ? -49.59 -16.95 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 95 ? ? 0.074 'SIDE CHAIN' 2 1 TYR A 296 ? ? 0.073 'SIDE CHAIN' 3 1 TYR A 345 ? ? 0.089 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLN 10 ? CG ? A GLN 10 CG 2 1 Y 0 A GLN 10 ? CD ? A GLN 10 CD 3 1 Y 0 A GLN 10 ? OE1 ? A GLN 10 OE1 4 1 Y 0 A GLN 10 ? NE2 ? A GLN 10 NE2 5 1 Y 0 A GLN 17 ? CG ? A GLN 17 CG 6 1 Y 0 A GLN 17 ? CD ? A GLN 17 CD 7 1 Y 0 A GLN 17 ? OE1 ? A GLN 17 OE1 8 1 Y 0 A GLN 17 ? NE2 ? A GLN 17 NE2 9 1 Y 0 A ASN 18 ? CG ? A ASN 18 CG 10 1 Y 0 A ASN 18 ? OD1 ? A ASN 18 OD1 11 1 Y 0 A ASN 18 ? ND2 ? A ASN 18 ND2 12 1 Y 0 A LYS 20 ? CG ? A LYS 20 CG 13 1 Y 0 A LYS 20 ? CD ? A LYS 20 CD 14 1 Y 0 A LYS 20 ? CE ? A LYS 20 CE 15 1 Y 0 A LYS 20 ? NZ ? A LYS 20 NZ 16 1 Y 0 A LYS 186 ? CG ? A LYS 186 CG 17 1 Y 0 A LYS 186 ? CD ? A LYS 186 CD 18 1 Y 0 A LYS 186 ? CE ? A LYS 186 CE 19 1 Y 0 A LYS 186 ? NZ ? A LYS 186 NZ 20 1 Y 0 A GLU 192 ? CD ? A GLU 192 CD 21 1 Y 0 A GLU 192 ? OE1 ? A GLU 192 OE1 22 1 Y 0 A GLU 192 ? OE2 ? A GLU 192 OE2 23 1 Y 0 A LYS 273 ? CG ? A LYS 273 CG 24 1 Y 0 A LYS 273 ? CD ? A LYS 273 CD 25 1 Y 0 A LYS 273 ? CE ? A LYS 273 CE 26 1 Y 0 A LYS 273 ? NZ ? A LYS 273 NZ 27 1 Y 0 A LYS 344 ? CG ? A LYS 344 CG 28 1 Y 0 A LYS 344 ? CD ? A LYS 344 CD 29 1 Y 0 A LYS 344 ? CE ? A LYS 344 CE 30 1 Y 0 A LYS 344 ? NZ ? A LYS 344 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 '2-OXALOSUCCINIC ACID' OXS #