data_1IDG # _entry.id 1IDG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IDG pdb_00001idg 10.2210/pdb1idg/pdb RCSB RCSB013180 ? ? WWPDB D_1000013180 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1IDH '1IDH IS 20 ENSEMBLE STRUCTURES OF THE COMPLEX BETWEEN ALPHA-BUNGAROTOXIN AND AN 18MER COGNATE PEPTIDE' unspecified PDB 1IDI '1IDI is the average structure of alpha-Bungarotoxin' unspecified PDB 1IDL '1IDL is 20 ensemble structures of alpha-Bungarotoxin' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IDG _pdbx_database_status.recvd_initial_deposition_date 2001-04-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zeng, H.' 1 'Moise, L.' 2 'Grant, M.A.' 3 'Hawrot, E.' 4 # _citation.id primary _citation.title ;The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 276 _citation.page_first 22930 _citation.page_last 22940 _citation.year 2001 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11312275 _citation.pdbx_database_id_DOI 10.1074/jbc.M102300200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zeng, H.' 1 ? primary 'Moise, L.' 2 ? primary 'Grant, M.A.' 3 ? primary 'Hawrot, E.' 4 ? # _cell.entry_id 1IDG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IDG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat ALPHA-BUNGAROTOXIN 8005.281 1 ? ? ? ? 2 polymer man 'ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN' 2424.732 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'LONG NEUROTOXIN 1' 2 NACHR-ALPHA1-SUBUNIT # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG A ? 2 'polypeptide(L)' no yes 'YRGWKHWVYYTCCPDTPY(HSL)' YRGWKHWVYYTCCPDTPYS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 CYS n 1 4 HIS n 1 5 THR n 1 6 THR n 1 7 ALA n 1 8 THR n 1 9 SER n 1 10 PRO n 1 11 ILE n 1 12 SER n 1 13 ALA n 1 14 VAL n 1 15 THR n 1 16 CYS n 1 17 PRO n 1 18 PRO n 1 19 GLY n 1 20 GLU n 1 21 ASN n 1 22 LEU n 1 23 CYS n 1 24 TYR n 1 25 ARG n 1 26 LYS n 1 27 MET n 1 28 TRP n 1 29 CYS n 1 30 ASP n 1 31 ALA n 1 32 PHE n 1 33 CYS n 1 34 SER n 1 35 SER n 1 36 ARG n 1 37 GLY n 1 38 LYS n 1 39 VAL n 1 40 VAL n 1 41 GLU n 1 42 LEU n 1 43 GLY n 1 44 CYS n 1 45 ALA n 1 46 ALA n 1 47 THR n 1 48 CYS n 1 49 PRO n 1 50 SER n 1 51 LYS n 1 52 LYS n 1 53 PRO n 1 54 TYR n 1 55 GLU n 1 56 GLU n 1 57 VAL n 1 58 THR n 1 59 CYS n 1 60 CYS n 1 61 SER n 1 62 THR n 1 63 ASP n 1 64 LYS n 1 65 CYS n 1 66 ASN n 1 67 PRO n 1 68 HIS n 1 69 PRO n 1 70 LYS n 1 71 GLN n 1 72 ARG n 1 73 PRO n 1 74 GLY n 2 1 TYR n 2 2 ARG n 2 3 GLY n 2 4 TRP n 2 5 LYS n 2 6 HIS n 2 7 TRP n 2 8 VAL n 2 9 TYR n 2 10 TYR n 2 11 THR n 2 12 CYS n 2 13 CYS n 2 14 PRO n 2 15 ASP n 2 16 THR n 2 17 PRO n 2 18 TYR n 2 19 HSL n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Pacific electric ray' _entity_src_gen.gene_src_genus Torpedo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Torpedo californica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7787 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET-31B(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'many-banded krait' _entity_src_nat.pdbx_organism_scientific 'Bungarus multicinctus' _entity_src_nat.pdbx_ncbi_taxonomy_id 8616 _entity_src_nat.genus Bungarus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details 'PURCHASED FROM SIGMA' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP NXL1A_BUNMU 1 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 1 P60615 ? 2 UNP ACHA_TORCA 2 YRGWKHWVYYTCCPDTPY 205 P02710 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1IDG A 1 ? 74 ? P60615 1 ? 74 ? 1 74 2 2 1IDG B 1 ? 18 ? P02710 205 ? 222 ? 181 198 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1IDG _struct_ref_seq_dif.mon_id HSL _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 19 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02710 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 199 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HSL 'L-peptide linking' n 'HOMOSERINE LACTONE' ? 'C4 H7 N O2' 101.104 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_TOCSY 2 1 1 '3D HNHA' 3 1 1 3D_15N-separated_NOESY 4 1 1 2D_TOCSY 5 1 1 2D_NOESY 6 1 1 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;2.1 mM alpha-Bungarotoxin/alpha18mer complex, alpha18mer is 15N labeled, 50 mM perdeuterated potassium acetate buffer (pH 4.0) with 5% D2O and 0.05% sodium azide ; _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1IDG _pdbx_nmr_refine.method 'distance geometry and simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1IDG _pdbx_nmr_details.text ;The chirality error is in THR 6 CB, OG1; ILE 11 CB, CG2; and THR 196 CB, OG1. There is no chirality error if MOLMOL is used to view the structure. ; # _pdbx_nmr_ensemble.entry_id 1IDG _pdbx_nmr_ensemble.conformers_calculated_total_number 1 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1IDG _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.1 collection Bruker 1 NMRPipe 1.8 processing 'Delaglio, F. et al.' 2 Sparky 3.95 'data analysis' 'Goddard, T.D. and Kneller, D.G.' 3 CNSsolve 1.0 refinement 'Brunger, A.T. et al.' 4 # _exptl.entry_id 1IDG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1IDG _struct.title 'THE NMR SOLUTION STRUCTURE OF THE COMPLEX FORMED BETWEEN ALPHA-BUNGAROTOXIN AND AN 18MER COGNATE PEPTIDE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1IDG _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'ALPHA-BUNGAROTOXIN, NICOTINIC ACETYLCHOLINE RECEPTOR, ALPHA 1 SUBUNIT, PROTEIN-PROTEIN INTERACTION, CATION-PI INTERACTION, TOXIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 3 A CYS 23 1_555 ? ? ? ? ? ? ? 2.008 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 16 A CYS 44 1_555 ? ? ? ? ? ? ? 2.003 ? ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 29 A CYS 33 1_555 ? ? ? ? ? ? ? 1.995 ? ? disulf4 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 48 A CYS 59 1_555 ? ? ? ? ? ? ? 2.012 ? ? disulf5 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 60 A CYS 65 1_555 ? ? ? ? ? ? ? 2.001 ? ? disulf6 disulf ? ? B CYS 12 SG ? ? ? 1_555 B CYS 13 SG ? ? B CYS 192 B CYS 193 1_555 ? ? ? ? ? ? ? 2.043 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 19 A . ? GLY 19 A GLU 20 A ? GLU 20 A 1 23.54 2 GLY 3 B . ? GLY 183 B TRP 4 B ? TRP 184 B 1 -4.48 3 LYS 5 B . ? LYS 185 B HIS 6 B ? HIS 186 B 1 11.62 4 TRP 7 B . ? TRP 187 B VAL 8 B ? VAL 188 B 1 -19.73 5 VAL 8 B . ? VAL 188 B TYR 9 B ? TYR 189 B 1 -21.40 6 ASP 15 B . ? ASP 195 B THR 16 B ? THR 196 B 1 -13.27 # _database_PDB_matrix.entry_id 1IDG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IDG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'THERE ARE SEVERAL CHIRALITY ERRORS IN CHAINS A AND B.' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLY 74 74 74 GLY GLY A . n B 2 1 TYR 1 181 181 TYR TYR B . n B 2 2 ARG 2 182 182 ARG ARG B . n B 2 3 GLY 3 183 183 GLY GLY B . n B 2 4 TRP 4 184 184 TRP TRP B . n B 2 5 LYS 5 185 185 LYS LYS B . n B 2 6 HIS 6 186 186 HIS HIS B . n B 2 7 TRP 7 187 187 TRP TRP B . n B 2 8 VAL 8 188 188 VAL VAL B . n B 2 9 TYR 9 189 189 TYR TYR B . n B 2 10 TYR 10 190 190 TYR TYR B . n B 2 11 THR 11 191 191 THR THR B . n B 2 12 CYS 12 192 192 CYS CYS B . n B 2 13 CYS 13 193 193 CYS CYS B . n B 2 14 PRO 14 194 194 PRO PRO B . n B 2 15 ASP 15 195 195 ASP ASP B . n B 2 16 THR 16 196 196 THR THR B . n B 2 17 PRO 17 197 197 PRO PRO B . n B 2 18 TYR 18 198 198 TYR TYR B . n B 2 19 HSL 19 199 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-04-25 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 C A ALA 31 ? ? C A PHE 32 ? ? 1.43 2 1 N A PRO 73 ? ? N A GLY 74 ? ? 1.52 3 1 C A GLY 19 ? ? H A GLU 20 ? ? 1.57 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 4 ? ? CD2 A HIS 4 ? ? 1.411 1.354 0.057 0.009 N 2 1 CG A HIS 68 ? ? CD2 A HIS 68 ? ? 1.410 1.354 0.056 0.009 N 3 1 C A ARG 72 ? ? N A PRO 73 ? ? 1.485 1.338 0.147 0.019 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 ND1 A HIS 4 ? ? CE1 A HIS 4 ? ? NE2 A HIS 4 ? ? 119.34 111.50 7.84 1.30 N 2 1 N A GLU 20 ? ? CA A GLU 20 ? ? C A GLU 20 ? ? 47.85 111.00 -63.15 2.70 N 3 1 CA A GLU 20 ? ? C A GLU 20 ? ? N A ASN 21 ? ? 99.17 117.20 -18.03 2.20 Y 4 1 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH1 A ARG 25 ? ? 124.38 120.30 4.08 0.50 N 5 1 CB A PHE 32 ? ? CA A PHE 32 ? ? C A PHE 32 ? ? 126.91 110.40 16.51 2.00 N 6 1 N A PHE 32 ? ? CA A PHE 32 ? ? C A PHE 32 ? ? 53.34 111.00 -57.66 2.70 N 7 1 CA A PHE 32 ? ? C A PHE 32 ? ? O A PHE 32 ? ? 104.33 120.10 -15.77 2.10 N 8 1 CA A PHE 32 ? ? C A PHE 32 ? ? N A CYS 33 ? ? 102.99 117.20 -14.21 2.20 Y 9 1 O A PHE 32 ? ? C A PHE 32 ? ? N A CYS 33 ? ? 112.91 122.70 -9.79 1.60 Y 10 1 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 124.23 120.30 3.93 0.50 N 11 1 ND1 A HIS 68 ? ? CE1 A HIS 68 ? ? NE2 A HIS 68 ? ? 119.50 111.50 8.00 1.30 N 12 1 N A ARG 72 ? ? CA A ARG 72 ? ? CB A ARG 72 ? ? 127.14 110.60 16.54 1.80 N 13 1 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 123.58 120.30 3.28 0.50 N 14 1 N A ARG 72 ? ? CA A ARG 72 ? ? C A ARG 72 ? ? 49.92 111.00 -61.08 2.70 N 15 1 CA A PRO 73 ? ? N A PRO 73 ? ? CD A PRO 73 ? ? 88.58 111.70 -23.12 1.40 N 16 1 N A PRO 73 ? ? CA A PRO 73 ? ? CB A PRO 73 ? ? 121.27 103.30 17.97 1.20 N 17 1 N A PRO 73 ? ? CD A PRO 73 ? ? CG A PRO 73 ? ? 117.53 103.20 14.33 1.50 N 18 1 N A PRO 73 ? ? CA A PRO 73 ? ? C A PRO 73 ? ? 51.50 112.10 -60.60 2.60 N 19 1 O A PRO 73 ? ? C A PRO 73 ? ? N A GLY 74 ? ? 111.22 123.20 -11.98 1.70 Y 20 1 NE B ARG 182 ? ? CZ B ARG 182 ? ? NH1 B ARG 182 ? ? 124.13 120.30 3.83 0.50 N 21 1 N B TRP 184 ? ? CA B TRP 184 ? ? CB B TRP 184 ? ? 124.74 110.60 14.14 1.80 N 22 1 ND1 B HIS 186 ? ? CE1 B HIS 186 ? ? NE2 B HIS 186 ? ? 119.58 111.50 8.08 1.30 N 23 1 CB B TRP 187 ? ? CA B TRP 187 ? ? C B TRP 187 ? ? 123.68 110.40 13.28 2.00 N 24 1 CA B TRP 187 ? ? C B TRP 187 ? ? N B VAL 188 ? ? 132.47 117.20 15.27 2.20 Y 25 1 O B TRP 187 ? ? C B TRP 187 ? ? N B VAL 188 ? ? 112.42 122.70 -10.28 1.60 Y 26 1 CB B VAL 188 ? ? CA B VAL 188 ? ? C B VAL 188 ? ? 124.28 111.40 12.88 1.90 N 27 1 CA B VAL 188 ? ? CB B VAL 188 ? ? CG2 B VAL 188 ? ? 122.00 110.90 11.10 1.50 N 28 1 O B VAL 188 ? ? C B VAL 188 ? ? N B TYR 189 ? ? 111.59 122.70 -11.11 1.60 Y 29 1 CB B CYS 193 ? ? CA B CYS 193 ? ? C B CYS 193 ? ? 118.84 111.50 7.34 1.20 N 30 1 CA B THR 196 ? ? CB B THR 196 ? ? CG2 B THR 196 ? ? 123.03 112.40 10.63 1.40 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 6 ? ? 68.62 -95.56 2 1 THR A 8 ? ? 72.29 -47.55 3 1 SER A 12 ? ? -165.23 -103.63 4 1 VAL A 14 ? ? -111.11 -140.94 5 1 THR A 15 ? ? 80.01 128.53 6 1 PRO A 17 ? ? -100.43 -62.47 7 1 PRO A 18 ? ? -68.92 -72.87 8 1 GLU A 20 ? ? 177.08 125.00 9 1 ASN A 21 ? ? 82.88 -133.25 10 1 TYR A 24 ? ? -45.97 86.60 11 1 CYS A 29 ? ? 56.33 76.90 12 1 ALA A 31 ? ? -155.58 -112.78 13 1 PHE A 32 ? ? 5.09 -124.31 14 1 CYS A 33 ? ? 50.99 94.03 15 1 SER A 34 ? ? -77.91 -70.01 16 1 SER A 35 ? ? -116.26 74.85 17 1 LYS A 38 ? ? 39.59 57.74 18 1 GLU A 41 ? ? -167.44 -83.71 19 1 LEU A 42 ? ? 48.29 129.37 20 1 CYS A 44 ? ? 62.94 143.74 21 1 LYS A 51 ? ? 178.40 16.64 22 1 LYS A 52 ? ? -110.78 -168.96 23 1 PRO A 53 ? ? -72.44 -70.43 24 1 GLU A 55 ? ? -114.74 -138.75 25 1 GLU A 56 ? ? 157.30 -75.79 26 1 CYS A 59 ? ? 57.27 150.56 27 1 THR A 62 ? ? 86.01 -65.24 28 1 ASP A 63 ? ? -132.69 -157.99 29 1 LYS A 64 ? ? -35.97 85.32 30 1 PRO A 67 ? ? -78.02 -91.11 31 1 HIS A 68 ? ? 177.40 -172.04 32 1 GLN A 71 ? ? 31.55 21.52 33 1 ARG B 182 ? ? 19.15 110.17 34 1 TRP B 184 ? ? 94.32 108.60 35 1 LYS B 185 ? ? 41.82 99.87 36 1 HIS B 186 ? ? 66.28 -170.03 37 1 TRP B 187 ? ? -128.79 -101.01 38 1 VAL B 188 ? ? 66.26 177.85 39 1 TYR B 189 ? ? 93.71 63.65 40 1 THR B 191 ? ? -32.35 -16.68 41 1 CYS B 193 ? ? 61.95 65.85 42 1 PRO B 194 ? ? -55.42 -175.08 43 1 PRO B 197 ? ? -88.79 -73.11 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 THR A 5 ? ? THR A 6 ? ? 121.19 2 1 THR A 6 ? ? ALA A 7 ? ? -139.48 3 1 THR A 8 ? ? SER A 9 ? ? -140.04 4 1 ALA A 13 ? ? VAL A 14 ? ? -143.04 5 1 CYS A 16 ? ? PRO A 17 ? ? -146.43 6 1 PRO A 18 ? ? GLY A 19 ? ? 129.62 7 1 GLU A 20 ? ? ASN A 21 ? ? 114.94 8 1 ASN A 21 ? ? LEU A 22 ? ? -134.56 9 1 ALA A 31 ? ? PHE A 32 ? ? 121.98 10 1 PHE A 32 ? ? CYS A 33 ? ? -112.60 11 1 GLU A 55 ? ? GLU A 56 ? ? -135.05 12 1 ASP A 63 ? ? LYS A 64 ? ? 122.88 13 1 HIS A 68 ? ? PRO A 69 ? ? 130.69 14 1 LYS A 70 ? ? GLN A 71 ? ? 149.59 15 1 ARG A 72 ? ? PRO A 73 ? ? -105.65 16 1 PRO A 73 ? ? GLY A 74 ? ? -104.65 17 1 TYR B 181 ? ? ARG B 182 ? ? 106.10 18 1 TRP B 184 ? ? LYS B 185 ? ? 110.90 19 1 HIS B 186 ? ? TRP B 187 ? ? -146.30 20 1 TYR B 190 ? ? THR B 191 ? ? 139.72 21 1 PRO B 194 ? ? ASP B 195 ? ? -108.61 22 1 PRO B 197 ? ? TYR B 198 ? ? 144.35 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 GLU A 20 ? ? -18.24 2 1 ALA A 31 ? ? 29.76 3 1 PHE A 32 ? ? 34.60 4 1 ARG A 72 ? ? -16.00 5 1 PRO A 73 ? ? -24.09 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 24 ? ? 0.070 'SIDE CHAIN' 2 1 ARG A 36 ? ? 0.083 'SIDE CHAIN' 3 1 TYR A 54 ? ? 0.102 'SIDE CHAIN' 4 1 ARG A 72 ? ? 0.076 'SIDE CHAIN' 5 1 TYR B 181 ? ? 0.065 'SIDE CHAIN' 6 1 TYR B 189 ? ? 0.083 'SIDE CHAIN' 7 1 TYR B 190 ? ? 0.138 'SIDE CHAIN' 8 1 TYR B 198 ? ? 0.071 'SIDE CHAIN' # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 CB ? A THR 6 ? 'WRONG HAND' . 2 1 CB ? A ILE 11 ? 'WRONG HAND' . 3 1 CB ? B THR 196 ? 'WRONG HAND' . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id B _pdbx_unobs_or_zero_occ_residues.auth_comp_id HSL _pdbx_unobs_or_zero_occ_residues.auth_seq_id 199 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id B _pdbx_unobs_or_zero_occ_residues.label_comp_id HSL _pdbx_unobs_or_zero_occ_residues.label_seq_id 19 #