data_1IE0
# 
_entry.id   1IE0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IE0         
RCSB  RCSB013192   
WWPDB D_1000013192 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IE0 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hilgers, M.T.' 1 
'Ludwig, M.L.'  2 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the quorum-sensing protein LuxS reveals a catalytic metal site.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            98 
_citation.page_first                11169 
_citation.page_last                 11174 
_citation.year                      2001 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11553770 
_citation.pdbx_database_id_DOI      10.1073/pnas.191223098 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hilgers, M.T.' 1 
primary 'Ludwig, M.L.'  2 
# 
_cell.entry_id           1IE0 
_cell.length_a           62.732 
_cell.length_b           62.732 
_cell.length_c           150.140 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IE0 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'AUTOINDUCER-2 PRODUCTION PROTEIN LUXS' 17786.229 1   ? ? ? ? 
2 non-polymer syn 'ZINC ION'                              65.409    1   ? ? ? ? 
3 non-polymer syn GLYCEROL                                92.094    1   ? ? ? ? 
4 water       nat water                                   18.015    187 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AI-2 SYNTHESIS PROTEIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS
PMG(OCS)QTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVF
G
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS
PMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   SER n 
1 4   VAL n 
1 5   GLU n 
1 6   SER n 
1 7   PHE n 
1 8   GLU n 
1 9   LEU n 
1 10  ASP n 
1 11  HIS n 
1 12  ASN n 
1 13  ALA n 
1 14  VAL n 
1 15  VAL n 
1 16  ALA n 
1 17  PRO n 
1 18  TYR n 
1 19  VAL n 
1 20  ARG n 
1 21  HIS n 
1 22  CYS n 
1 23  GLY n 
1 24  VAL n 
1 25  HIS n 
1 26  LYS n 
1 27  VAL n 
1 28  GLY n 
1 29  THR n 
1 30  ASP n 
1 31  GLY n 
1 32  VAL n 
1 33  VAL n 
1 34  ASN n 
1 35  LYS n 
1 36  PHE n 
1 37  ASP n 
1 38  ILE n 
1 39  ARG n 
1 40  PHE n 
1 41  CYS n 
1 42  GLN n 
1 43  PRO n 
1 44  ASN n 
1 45  LYS n 
1 46  GLN n 
1 47  ALA n 
1 48  MET n 
1 49  LYS n 
1 50  PRO n 
1 51  ASP n 
1 52  THR n 
1 53  ILE n 
1 54  HIS n 
1 55  THR n 
1 56  LEU n 
1 57  GLU n 
1 58  HIS n 
1 59  LEU n 
1 60  LEU n 
1 61  ALA n 
1 62  PHE n 
1 63  THR n 
1 64  ILE n 
1 65  ARG n 
1 66  SER n 
1 67  HIS n 
1 68  ALA n 
1 69  GLU n 
1 70  LYS n 
1 71  TYR n 
1 72  ASP n 
1 73  HIS n 
1 74  PHE n 
1 75  ASP n 
1 76  ILE n 
1 77  ILE n 
1 78  ASP n 
1 79  ILE n 
1 80  SER n 
1 81  PRO n 
1 82  MET n 
1 83  GLY n 
1 84  OCS n 
1 85  GLN n 
1 86  THR n 
1 87  GLY n 
1 88  TYR n 
1 89  TYR n 
1 90  LEU n 
1 91  VAL n 
1 92  VAL n 
1 93  SER n 
1 94  GLY n 
1 95  GLU n 
1 96  PRO n 
1 97  THR n 
1 98  SER n 
1 99  ALA n 
1 100 GLU n 
1 101 ILE n 
1 102 VAL n 
1 103 ASP n 
1 104 LEU n 
1 105 LEU n 
1 106 GLU n 
1 107 ASP n 
1 108 THR n 
1 109 MET n 
1 110 LYS n 
1 111 GLU n 
1 112 ALA n 
1 113 VAL n 
1 114 GLU n 
1 115 ILE n 
1 116 THR n 
1 117 GLU n 
1 118 ILE n 
1 119 PRO n 
1 120 ALA n 
1 121 ALA n 
1 122 ASN n 
1 123 GLU n 
1 124 LYS n 
1 125 GLN n 
1 126 CYS n 
1 127 GLY n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 LEU n 
1 132 HIS n 
1 133 ASP n 
1 134 LEU n 
1 135 GLU n 
1 136 GLY n 
1 137 ALA n 
1 138 LYS n 
1 139 ARG n 
1 140 LEU n 
1 141 MET n 
1 142 ARG n 
1 143 PHE n 
1 144 TRP n 
1 145 LEU n 
1 146 SER n 
1 147 GLN n 
1 148 ASP n 
1 149 LYS n 
1 150 GLU n 
1 151 GLU n 
1 152 LEU n 
1 153 LEU n 
1 154 LYS n 
1 155 VAL n 
1 156 PHE n 
1 157 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacillus 
_entity_src_gen.pdbx_gene_src_gene                 LUXS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1423 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET29 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LUXS_BACSU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O34667 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS
PMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IE0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 157 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O34667 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  157 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       157 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1IE0 
_struct_ref_seq_dif.mon_id                       OCS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      84 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   O34667 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          84 
_struct_ref_seq_dif.details                      'MODIFIED RESIDUE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            84 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE               ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ?                               'C5 H11 N O2 S'  149.211 
OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ?                               'C3 H7 N O5 S'   169.156 
PHE 'L-peptide linking' y PHENYLALANINE           ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'              ?                               'Zn 2'           65.409  
# 
_exptl.entry_id          1IE0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   46.2 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'Ammonium sulfate, Tris-HCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           140 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1999-08-22 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'YALE MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1IE0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            1.6 
_reflns.number_obs                   23431 
_reflns.number_all                   23431 
_reflns.percent_possible_obs         98 
_reflns.pdbx_Rmerge_I_obs            0.0630000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        30.5 
_reflns.B_iso_Wilson_estimate        24.4 
_reflns.pdbx_redundancy              8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   92.8 
_reflns_shell.Rmerge_I_obs           0.3570000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IE0 
_refine.ls_number_reflns_obs                     21965 
_refine.ls_number_reflns_all                     21965 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            1.6 
_refine.ls_percent_reflns_obs                    91.8 
_refine.ls_R_factor_obs                          0.1740000 
_refine.ls_R_factor_all                          0.1740000 
_refine.ls_R_factor_R_work                       0.1740000 
_refine.ls_R_factor_R_free                       0.2090000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  2203 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               24.3 
_refine.aniso_B[1][1]                            -1.936 
_refine.aniso_B[2][2]                            -1.936 
_refine.aniso_B[3][3]                            3.872 
_refine.aniso_B[1][2]                            -2.279 
_refine.aniso_B[1][3]                            0.0 
_refine.aniso_B[2][3]                            0.0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 0.404425 
_refine.solvent_model_param_bsol                 63.204 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'MEASURED REFLECTIONS WITH |F| = 0 NOT USED IN REFINEMENT.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1237 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             187 
_refine_hist.number_atoms_total               1431 
_refine_hist.d_res_high                       1.6 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d                0.01561 ?   ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_na             ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_prot           ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d               ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_na            ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_prot          ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg             1.81733 ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_na          ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_prot        ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d      ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_na   ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_prot ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d      ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_na   ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_prot ?       ?   ? ? 'X-RAY DIFFRACTION' ? 
o_mcbond_it             3.03    1.5 ? ? 'X-RAY DIFFRACTION' ? 
o_mcangle_it            5.09    2.0 ? ? 'X-RAY DIFFRACTION' ? 
o_scbond_it             3.71    2.0 ? ? 'X-RAY DIFFRACTION' ? 
o_scangle_it            6.52    2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.6 
_refine_ls_shell.d_res_low                        1.67 
_refine_ls_shell.number_reflns_R_work             1290 
_refine_ls_shell.R_factor_R_work                  0.3365000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3810000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             134 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 gol.par           gol.top     'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
5 cyo.par           cyo.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1IE0 
_struct.title                     'CRYSTAL STRUCTURE OF LUXS' 
_struct.pdbx_descriptor           'AUTOINDUCER-2 PRODUCTION PROTEIN LUXS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IE0 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS' 
_struct_keywords.text            'four stranded antiparallel beta sheet, cysteine-sulfonic acid, structural genomics' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The second part of the biological assembly (dimer) is generated  
by the crystallographic two  
fold.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 3   ? LEU A 9   ? SER A 3   LEU A 9   5 ? 7  
HELX_P HELX_P2 2 LYS A 49  ? GLU A 69  ? LYS A 49  GLU A 69  1 ? 21 
HELX_P HELX_P3 3 THR A 97  ? VAL A 113 ? THR A 97  VAL A 113 1 ? 17 
HELX_P HELX_P4 4 ASP A 133 ? SER A 146 ? ASP A 133 SER A 146 1 ? 14 
HELX_P HELX_P5 5 ASP A 148 ? LEU A 153 ? ASP A 148 LEU A 153 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A GLY 83 C  ? ? ? 1_555 A OCS 84  N   ? ? A GLY 83   A OCS 84   1_555 ? ? ? ? ? ? ? 1.343 ? 
covale2 covale ? ? A OCS 84 C  ? ? ? 1_555 A GLN 85  N   ? ? A OCS 84   A GLN 85   1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc1 metalc ? ? B ZN  .  ZN ? ? ? 1_555 A CYS 126 SG  ? ? A ZN  1001 A CYS 126  1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc2 metalc ? ? B ZN  .  ZN ? ? ? 1_555 A HIS 54  NE2 ? ? A ZN  1001 A HIS 54   1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc3 metalc ? ? B ZN  .  ZN ? ? ? 1_555 D HOH .   O   ? ? A ZN  1001 A HOH 1002 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc4 metalc ? ? B ZN  .  ZN ? ? ? 1_555 A HIS 58  NE2 ? ? A ZN  1001 A HIS 58   1_555 ? ? ? ? ? ? ? 2.130 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           16 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            16 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    17 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     17 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.57 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 18 ? VAL A 27 ? TYR A 18 VAL A 27 
A 2 GLY A 31 ? ARG A 39 ? GLY A 31 ARG A 39 
A 3 GLY A 87 ? GLY A 94 ? GLY A 87 GLY A 94 
A 4 PHE A 74 ? PRO A 81 ? PHE A 74 PRO A 81 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 27 ? N VAL A 27 O GLY A 31 ? O GLY A 31 
A 2 3 N ILE A 38 ? N ILE A 38 O TYR A 88 ? O TYR A 88 
A 3 4 N SER A 93 ? N SER A 93 O ASP A 75 ? O ASP A 75 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1001' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS A 54  ? HIS A 54   . ? 1_555 ? 
2  AC1 4  HIS A 58  ? HIS A 58   . ? 1_555 ? 
3  AC1 4  CYS A 126 ? CYS A 126  . ? 1_555 ? 
4  AC1 4  HOH D .   ? HOH A 1002 . ? 1_555 ? 
5  AC2 10 VAL A 32  ? VAL A 32   . ? 8_566 ? 
6  AC2 10 PHE A 40  ? PHE A 40   . ? 1_555 ? 
7  AC2 10 CYS A 41  ? CYS A 41   . ? 1_555 ? 
8  AC2 10 GLN A 46  ? GLN A 46   . ? 1_555 ? 
9  AC2 10 GLU A 95  ? GLU A 95   . ? 8_566 ? 
10 AC2 10 LEU A 140 ? LEU A 140  . ? 1_555 ? 
11 AC2 10 PHE A 143 ? PHE A 143  . ? 1_555 ? 
12 AC2 10 HOH D .   ? HOH A 1018 . ? 1_555 ? 
13 AC2 10 HOH D .   ? HOH A 1034 . ? 1_555 ? 
14 AC2 10 HOH D .   ? HOH A 1155 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IE0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IE0 
_atom_sites.fract_transf_matrix[1][1]   0.015941 
_atom_sites.fract_transf_matrix[1][2]   0.009203 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018407 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006660 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  HIS 11  11  11  HIS HIS A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  HIS 21  21  21  HIS HIS A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  HIS 25  25  25  HIS HIS A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  PHE 40  40  40  PHE PHE A . n 
A 1 41  CYS 41  41  41  CYS CYS A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  OCS 84  84  84  OCS CYO A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 GLN 128 128 128 GLN GLN A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 MET 141 141 141 MET MET A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 TRP 144 144 144 TRP TRP A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 SER 146 146 146 SER THR A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    OCS 
_pdbx_struct_mod_residue.label_seq_id     84 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     OCS 
_pdbx_struct_mod_residue.auth_seq_id      84 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          'CYSTEINESULFONIC ACID' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4930  ? 
1 MORE         -97   ? 
1 'SSA (A^2)'  12360 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 10_666 -y+1,-x+1,-z+7/6 0.5000000000 -0.8660254038 0.0000000000 31.3660000000 -0.8660254038 
-0.5000000000 0.0000000000 54.3275056302 0.0000000000 0.0000000000 -1.0000000000 175.1633333333 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? A CYS 126 ? A CYS 126  ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 54 ? A HIS 54   ? 1_555 105.0 ? 
2 SG  ? A CYS 126 ? A CYS 126  ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 O   ? D HOH .  ? A HOH 1002 ? 1_555 116.3 ? 
3 NE2 ? A HIS 54  ? A HIS 54   ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 O   ? D HOH .  ? A HOH 1002 ? 1_555 112.7 ? 
4 SG  ? A CYS 126 ? A CYS 126  ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 58 ? A HIS 58   ? 1_555 116.3 ? 
5 NE2 ? A HIS 54  ? A HIS 54   ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 58 ? A HIS 58   ? 1_555 104.6 ? 
6 O   ? D HOH .   ? A HOH 1002 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 58 ? A HIS 58   ? 1_555 101.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-03 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SOLVE     phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 1185 ? ? O A HOH 1186 ? ? 1.94 
2 1 OE2 A GLU 5    ? ? O A HOH 1169 ? ? 2.13 
3 1 O   A HOH 1016 ? ? O A HOH 1095 ? ? 2.16 
4 1 OD1 A OCS 84   ? ? O A HOH 1081 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NH1 A ARG 142  ? ? 1_555 O A HOH 1113 ? ? 8_566  2.00 
2 1 O   A HOH 1173 ? ? 1_555 O A HOH 1173 ? ? 10_666 2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 4   ? ? -29.90  -26.75 
2 1 GLN A 128 ? ? -157.51 75.07  
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 GLYCEROL   GOL 
4 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   1001 1001 ZN  ZN2 A . 
C 3 GOL 1   301  301  GOL GOL A . 
D 4 HOH 1   1002 1    HOH TIP A . 
D 4 HOH 2   1003 2    HOH TIP A . 
D 4 HOH 3   1004 3    HOH TIP A . 
D 4 HOH 4   1005 4    HOH TIP A . 
D 4 HOH 5   1006 5    HOH TIP A . 
D 4 HOH 6   1007 6    HOH TIP A . 
D 4 HOH 7   1008 7    HOH TIP A . 
D 4 HOH 8   1009 8    HOH TIP A . 
D 4 HOH 9   1010 9    HOH TIP A . 
D 4 HOH 10  1011 10   HOH TIP A . 
D 4 HOH 11  1012 11   HOH TIP A . 
D 4 HOH 12  1013 12   HOH TIP A . 
D 4 HOH 13  1014 13   HOH TIP A . 
D 4 HOH 14  1015 14   HOH TIP A . 
D 4 HOH 15  1016 15   HOH TIP A . 
D 4 HOH 16  1017 16   HOH TIP A . 
D 4 HOH 17  1018 17   HOH TIP A . 
D 4 HOH 18  1019 18   HOH TIP A . 
D 4 HOH 19  1020 19   HOH TIP A . 
D 4 HOH 20  1021 20   HOH TIP A . 
D 4 HOH 21  1022 21   HOH TIP A . 
D 4 HOH 22  1023 22   HOH TIP A . 
D 4 HOH 23  1024 23   HOH TIP A . 
D 4 HOH 24  1025 24   HOH TIP A . 
D 4 HOH 25  1026 25   HOH TIP A . 
D 4 HOH 26  1027 26   HOH TIP A . 
D 4 HOH 27  1028 27   HOH TIP A . 
D 4 HOH 28  1029 28   HOH TIP A . 
D 4 HOH 29  1030 29   HOH TIP A . 
D 4 HOH 30  1031 30   HOH TIP A . 
D 4 HOH 31  1032 31   HOH TIP A . 
D 4 HOH 32  1033 32   HOH TIP A . 
D 4 HOH 33  1034 33   HOH TIP A . 
D 4 HOH 34  1035 34   HOH TIP A . 
D 4 HOH 35  1036 35   HOH TIP A . 
D 4 HOH 36  1037 36   HOH TIP A . 
D 4 HOH 37  1038 37   HOH TIP A . 
D 4 HOH 38  1039 38   HOH TIP A . 
D 4 HOH 39  1040 39   HOH TIP A . 
D 4 HOH 40  1041 40   HOH TIP A . 
D 4 HOH 41  1042 41   HOH TIP A . 
D 4 HOH 42  1043 42   HOH TIP A . 
D 4 HOH 43  1044 43   HOH TIP A . 
D 4 HOH 44  1045 44   HOH TIP A . 
D 4 HOH 45  1046 45   HOH TIP A . 
D 4 HOH 46  1047 46   HOH TIP A . 
D 4 HOH 47  1048 47   HOH TIP A . 
D 4 HOH 48  1049 48   HOH TIP A . 
D 4 HOH 49  1050 49   HOH TIP A . 
D 4 HOH 50  1051 50   HOH TIP A . 
D 4 HOH 51  1052 51   HOH TIP A . 
D 4 HOH 52  1053 52   HOH TIP A . 
D 4 HOH 53  1054 53   HOH TIP A . 
D 4 HOH 54  1055 54   HOH TIP A . 
D 4 HOH 55  1056 55   HOH TIP A . 
D 4 HOH 56  1057 56   HOH TIP A . 
D 4 HOH 57  1058 57   HOH TIP A . 
D 4 HOH 58  1059 58   HOH TIP A . 
D 4 HOH 59  1060 59   HOH TIP A . 
D 4 HOH 60  1061 60   HOH TIP A . 
D 4 HOH 61  1062 61   HOH TIP A . 
D 4 HOH 62  1063 62   HOH TIP A . 
D 4 HOH 63  1064 63   HOH TIP A . 
D 4 HOH 64  1065 64   HOH TIP A . 
D 4 HOH 65  1066 65   HOH TIP A . 
D 4 HOH 66  1067 66   HOH TIP A . 
D 4 HOH 67  1068 67   HOH TIP A . 
D 4 HOH 68  1069 68   HOH TIP A . 
D 4 HOH 69  1070 69   HOH TIP A . 
D 4 HOH 70  1071 70   HOH TIP A . 
D 4 HOH 71  1072 71   HOH TIP A . 
D 4 HOH 72  1073 72   HOH TIP A . 
D 4 HOH 73  1074 73   HOH TIP A . 
D 4 HOH 74  1075 74   HOH TIP A . 
D 4 HOH 75  1076 75   HOH TIP A . 
D 4 HOH 76  1077 76   HOH TIP A . 
D 4 HOH 77  1078 77   HOH TIP A . 
D 4 HOH 78  1079 78   HOH TIP A . 
D 4 HOH 79  1080 79   HOH TIP A . 
D 4 HOH 80  1081 80   HOH TIP A . 
D 4 HOH 81  1082 81   HOH TIP A . 
D 4 HOH 82  1083 82   HOH TIP A . 
D 4 HOH 83  1084 83   HOH TIP A . 
D 4 HOH 84  1085 84   HOH TIP A . 
D 4 HOH 85  1086 85   HOH TIP A . 
D 4 HOH 86  1087 86   HOH TIP A . 
D 4 HOH 87  1088 87   HOH TIP A . 
D 4 HOH 88  1089 88   HOH TIP A . 
D 4 HOH 89  1090 89   HOH TIP A . 
D 4 HOH 90  1091 90   HOH TIP A . 
D 4 HOH 91  1092 91   HOH TIP A . 
D 4 HOH 92  1093 92   HOH TIP A . 
D 4 HOH 93  1094 93   HOH TIP A . 
D 4 HOH 94  1095 94   HOH TIP A . 
D 4 HOH 95  1096 95   HOH TIP A . 
D 4 HOH 96  1097 96   HOH TIP A . 
D 4 HOH 97  1098 97   HOH TIP A . 
D 4 HOH 98  1099 98   HOH TIP A . 
D 4 HOH 99  1100 99   HOH TIP A . 
D 4 HOH 100 1101 100  HOH TIP A . 
D 4 HOH 101 1102 101  HOH TIP A . 
D 4 HOH 102 1103 102  HOH TIP A . 
D 4 HOH 103 1104 103  HOH TIP A . 
D 4 HOH 104 1105 104  HOH TIP A . 
D 4 HOH 105 1106 105  HOH TIP A . 
D 4 HOH 106 1107 106  HOH TIP A . 
D 4 HOH 107 1108 107  HOH TIP A . 
D 4 HOH 108 1109 108  HOH TIP A . 
D 4 HOH 109 1110 109  HOH TIP A . 
D 4 HOH 110 1111 110  HOH TIP A . 
D 4 HOH 111 1112 111  HOH TIP A . 
D 4 HOH 112 1113 112  HOH TIP A . 
D 4 HOH 113 1114 113  HOH TIP A . 
D 4 HOH 114 1115 114  HOH TIP A . 
D 4 HOH 115 1116 115  HOH TIP A . 
D 4 HOH 116 1117 116  HOH TIP A . 
D 4 HOH 117 1118 117  HOH TIP A . 
D 4 HOH 118 1119 118  HOH TIP A . 
D 4 HOH 119 1120 119  HOH TIP A . 
D 4 HOH 120 1121 120  HOH TIP A . 
D 4 HOH 121 1122 121  HOH TIP A . 
D 4 HOH 122 1123 122  HOH TIP A . 
D 4 HOH 123 1124 123  HOH TIP A . 
D 4 HOH 124 1125 124  HOH TIP A . 
D 4 HOH 125 1126 125  HOH TIP A . 
D 4 HOH 126 1127 126  HOH TIP A . 
D 4 HOH 127 1128 127  HOH TIP A . 
D 4 HOH 128 1129 128  HOH TIP A . 
D 4 HOH 129 1130 129  HOH TIP A . 
D 4 HOH 130 1131 130  HOH TIP A . 
D 4 HOH 131 1132 131  HOH TIP A . 
D 4 HOH 132 1133 132  HOH TIP A . 
D 4 HOH 133 1134 133  HOH TIP A . 
D 4 HOH 134 1135 134  HOH TIP A . 
D 4 HOH 135 1136 135  HOH TIP A . 
D 4 HOH 136 1137 136  HOH TIP A . 
D 4 HOH 137 1138 137  HOH TIP A . 
D 4 HOH 138 1139 138  HOH TIP A . 
D 4 HOH 139 1140 139  HOH TIP A . 
D 4 HOH 140 1141 140  HOH TIP A . 
D 4 HOH 141 1142 141  HOH TIP A . 
D 4 HOH 142 1143 142  HOH TIP A . 
D 4 HOH 143 1144 143  HOH TIP A . 
D 4 HOH 144 1145 144  HOH TIP A . 
D 4 HOH 145 1146 145  HOH TIP A . 
D 4 HOH 146 1147 146  HOH TIP A . 
D 4 HOH 147 1148 147  HOH TIP A . 
D 4 HOH 148 1149 148  HOH TIP A . 
D 4 HOH 149 1150 149  HOH TIP A . 
D 4 HOH 150 1151 150  HOH TIP A . 
D 4 HOH 151 1152 151  HOH TIP A . 
D 4 HOH 152 1153 152  HOH TIP A . 
D 4 HOH 153 1154 153  HOH TIP A . 
D 4 HOH 154 1155 154  HOH TIP A . 
D 4 HOH 155 1156 155  HOH TIP A . 
D 4 HOH 156 1157 156  HOH TIP A . 
D 4 HOH 157 1158 157  HOH TIP A . 
D 4 HOH 158 1159 158  HOH TIP A . 
D 4 HOH 159 1160 159  HOH TIP A . 
D 4 HOH 160 1161 160  HOH TIP A . 
D 4 HOH 161 1162 161  HOH TIP A . 
D 4 HOH 162 1163 162  HOH TIP A . 
D 4 HOH 163 1164 163  HOH TIP A . 
D 4 HOH 164 1165 164  HOH TIP A . 
D 4 HOH 165 1166 165  HOH TIP A . 
D 4 HOH 166 1167 166  HOH TIP A . 
D 4 HOH 167 1168 167  HOH TIP A . 
D 4 HOH 168 1169 168  HOH TIP A . 
D 4 HOH 169 1170 169  HOH TIP A . 
D 4 HOH 170 1171 170  HOH TIP A . 
D 4 HOH 171 1172 171  HOH TIP A . 
D 4 HOH 172 1173 172  HOH TIP A . 
D 4 HOH 173 1174 173  HOH TIP A . 
D 4 HOH 174 1175 174  HOH TIP A . 
D 4 HOH 175 1176 175  HOH TIP A . 
D 4 HOH 176 1177 176  HOH TIP A . 
D 4 HOH 177 1178 177  HOH TIP A . 
D 4 HOH 178 1179 178  HOH TIP A . 
D 4 HOH 179 1180 179  HOH TIP A . 
D 4 HOH 180 1181 180  HOH TIP A . 
D 4 HOH 181 1182 181  HOH TIP A . 
D 4 HOH 182 1183 182  HOH TIP A . 
D 4 HOH 183 1184 183  HOH TIP A . 
D 4 HOH 184 1185 184  HOH TIP A . 
D 4 HOH 185 1186 185  HOH TIP A . 
D 4 HOH 186 1187 186  HOH TIP A . 
D 4 HOH 187 1188 187  HOH TIP A . 
#