data_1IEU # _entry.id 1IEU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IEU pdb_00001ieu 10.2210/pdb1ieu/pdb WWPDB D_1000174125 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1IET _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IEU _pdbx_database_status.recvd_initial_deposition_date 1996-04-20 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Falzone, C.J.' 1 'Lecomte, J.T.J.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Design challenges for hemoproteins: the solution structure of apocytochrome b5.' Biochemistry 35 6519 6526 1996 BICHAW US 0006-2960 0033 ? 8639599 10.1021/bi960501q 1 'The X-Ray Crystallographic Structure of Calf Liver Cytochrome B5' 'The Porphyrins V.7: Biochemistry, Pt.B' 7 107 ? 1979 ? ? 0-12-220107-8 2042 'New York : Academic Press' ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Falzone, C.J.' 1 ? primary 'Mayer, M.R.' 2 ? primary 'Whiteman, E.L.' 3 ? primary 'Moore, C.D.' 4 ? primary 'Lecomte, J.T.' 5 ? 1 'Mathews, F.S.' 6 ? 1 'Czerwinski, E.W.' 7 ? 1 'Argos, P.' 8 ? # _citation_editor.citation_id 1 _citation_editor.name 'Dolphin, D.' _citation_editor.ordinal 1 # _cell.entry_id 1IEU _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IEU _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'APOCYTOCHROME B5' _entity.formula_weight 11229.305 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYII GELHPDDRSKIAKPSETL ; _entity_poly.pdbx_seq_one_letter_code_can ;AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYII GELHPDDRSKIAKPSETL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 GLN n 1 4 SER n 1 5 ASP n 1 6 LYS n 1 7 ASP n 1 8 VAL n 1 9 LYS n 1 10 TYR n 1 11 TYR n 1 12 THR n 1 13 LEU n 1 14 GLU n 1 15 GLU n 1 16 ILE n 1 17 GLN n 1 18 LYS n 1 19 HIS n 1 20 LYS n 1 21 ASP n 1 22 SER n 1 23 LYS n 1 24 SER n 1 25 THR n 1 26 TRP n 1 27 VAL n 1 28 ILE n 1 29 LEU n 1 30 HIS n 1 31 HIS n 1 32 LYS n 1 33 VAL n 1 34 TYR n 1 35 ASP n 1 36 LEU n 1 37 THR n 1 38 LYS n 1 39 PHE n 1 40 LEU n 1 41 GLU n 1 42 GLU n 1 43 HIS n 1 44 PRO n 1 45 GLY n 1 46 GLY n 1 47 GLU n 1 48 GLU n 1 49 VAL n 1 50 LEU n 1 51 ARG n 1 52 GLU n 1 53 GLN n 1 54 ALA n 1 55 GLY n 1 56 GLY n 1 57 ASP n 1 58 ALA n 1 59 THR n 1 60 GLU n 1 61 ASN n 1 62 PHE n 1 63 GLU n 1 64 ASP n 1 65 VAL n 1 66 GLY n 1 67 HIS n 1 68 SER n 1 69 THR n 1 70 ASP n 1 71 ALA n 1 72 ARG n 1 73 GLU n 1 74 LEU n 1 75 SER n 1 76 LYS n 1 77 THR n 1 78 TYR n 1 79 ILE n 1 80 ILE n 1 81 GLY n 1 82 GLU n 1 83 LEU n 1 84 HIS n 1 85 PRO n 1 86 ASP n 1 87 ASP n 1 88 ARG n 1 89 SER n 1 90 LYS n 1 91 ILE n 1 92 ALA n 1 93 LYS n 1 94 PRO n 1 95 SER n 1 96 GLU n 1 97 THR n 1 98 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene CYTB5 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ LIVER _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene CYTB5 _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-3D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYB5_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00173 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYII GELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISALVVALMYRLYMAED ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IEU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00173 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -3 _struct_ref_seq.pdbx_auth_seq_align_end 94 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_ensemble.entry_id 1IEU _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1IEU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1IEU _struct.title 'APOCYTOCHROME B5, PH 6.2, 298 K, NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IEU _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 13 ? LYS A 18 ? LEU A 9 LYS A 14 1 ? 6 HELX_P HELX_P2 2 PHE A 39 ? GLU A 42 ? PHE A 35 GLU A 38 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1IEU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IEU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -3 ? ? ? A . n A 1 2 GLU 2 -2 ? ? ? A . n A 1 3 GLN 3 -1 ? ? ? A . n A 1 4 SER 4 0 ? ? ? A . n A 1 5 ASP 5 1 1 ASP ASP A . n A 1 6 LYS 6 2 2 LYS LYS A . n A 1 7 ASP 7 3 3 ASP ASP A . n A 1 8 VAL 8 4 4 VAL VAL A . n A 1 9 LYS 9 5 5 LYS LYS A . n A 1 10 TYR 10 6 6 TYR TYR A . n A 1 11 TYR 11 7 7 TYR TYR A . n A 1 12 THR 12 8 8 THR THR A . n A 1 13 LEU 13 9 9 LEU LEU A . n A 1 14 GLU 14 10 10 GLU GLU A . n A 1 15 GLU 15 11 11 GLU GLU A . n A 1 16 ILE 16 12 12 ILE ILE A . n A 1 17 GLN 17 13 13 GLN GLN A . n A 1 18 LYS 18 14 14 LYS LYS A . n A 1 19 HIS 19 15 15 HIS HIS A . n A 1 20 LYS 20 16 16 LYS LYS A . n A 1 21 ASP 21 17 17 ASP ASP A . n A 1 22 SER 22 18 18 SER SER A . n A 1 23 LYS 23 19 19 LYS LYS A . n A 1 24 SER 24 20 20 SER SER A . n A 1 25 THR 25 21 21 THR THR A . n A 1 26 TRP 26 22 22 TRP TRP A . n A 1 27 VAL 27 23 23 VAL VAL A . n A 1 28 ILE 28 24 24 ILE ILE A . n A 1 29 LEU 29 25 25 LEU LEU A . n A 1 30 HIS 30 26 26 HIS HIS A . n A 1 31 HIS 31 27 27 HIS HIS A . n A 1 32 LYS 32 28 28 LYS LYS A . n A 1 33 VAL 33 29 29 VAL VAL A . n A 1 34 TYR 34 30 30 TYR TYR A . n A 1 35 ASP 35 31 31 ASP ASP A . n A 1 36 LEU 36 32 32 LEU LEU A . n A 1 37 THR 37 33 33 THR THR A . n A 1 38 LYS 38 34 34 LYS LYS A . n A 1 39 PHE 39 35 35 PHE PHE A . n A 1 40 LEU 40 36 36 LEU LEU A . n A 1 41 GLU 41 37 37 GLU GLU A . n A 1 42 GLU 42 38 38 GLU GLU A . n A 1 43 HIS 43 39 39 HIS HIS A . n A 1 44 PRO 44 40 40 PRO PRO A . n A 1 45 GLY 45 41 41 GLY GLY A . n A 1 46 GLY 46 42 42 GLY GLY A . n A 1 47 GLU 47 43 43 GLU GLU A . n A 1 48 GLU 48 44 44 GLU GLU A . n A 1 49 VAL 49 45 45 VAL VAL A . n A 1 50 LEU 50 46 46 LEU LEU A . n A 1 51 ARG 51 47 47 ARG ARG A . n A 1 52 GLU 52 48 48 GLU GLU A . n A 1 53 GLN 53 49 49 GLN GLN A . n A 1 54 ALA 54 50 50 ALA ALA A . n A 1 55 GLY 55 51 51 GLY GLY A . n A 1 56 GLY 56 52 52 GLY GLY A . n A 1 57 ASP 57 53 53 ASP ASP A . n A 1 58 ALA 58 54 54 ALA ALA A . n A 1 59 THR 59 55 55 THR THR A . n A 1 60 GLU 60 56 56 GLU GLU A . n A 1 61 ASN 61 57 57 ASN ASN A . n A 1 62 PHE 62 58 58 PHE PHE A . n A 1 63 GLU 63 59 59 GLU GLU A . n A 1 64 ASP 64 60 60 ASP ASP A . n A 1 65 VAL 65 61 61 VAL VAL A . n A 1 66 GLY 66 62 62 GLY GLY A . n A 1 67 HIS 67 63 63 HIS HIS A . n A 1 68 SER 68 64 64 SER SER A . n A 1 69 THR 69 65 65 THR THR A . n A 1 70 ASP 70 66 66 ASP ASP A . n A 1 71 ALA 71 67 67 ALA ALA A . n A 1 72 ARG 72 68 68 ARG ARG A . n A 1 73 GLU 73 69 69 GLU GLU A . n A 1 74 LEU 74 70 70 LEU LEU A . n A 1 75 SER 75 71 71 SER SER A . n A 1 76 LYS 76 72 72 LYS LYS A . n A 1 77 THR 77 73 73 THR THR A . n A 1 78 TYR 78 74 74 TYR TYR A . n A 1 79 ILE 79 75 75 ILE ILE A . n A 1 80 ILE 80 76 76 ILE ILE A . n A 1 81 GLY 81 77 77 GLY GLY A . n A 1 82 GLU 82 78 78 GLU GLU A . n A 1 83 LEU 83 79 79 LEU LEU A . n A 1 84 HIS 84 80 80 HIS HIS A . n A 1 85 PRO 85 81 81 PRO PRO A . n A 1 86 ASP 86 82 82 ASP ASP A . n A 1 87 ASP 87 83 83 ASP ASP A . n A 1 88 ARG 88 84 84 ARG ARG A . n A 1 89 SER 89 85 85 SER SER A . n A 1 90 LYS 90 86 86 LYS LYS A . n A 1 91 ILE 91 87 87 ILE ILE A . n A 1 92 ALA 92 88 88 ALA ALA A . n A 1 93 LYS 93 89 89 LYS LYS A . n A 1 94 PRO 94 90 90 PRO PRO A . n A 1 95 SER 95 91 91 SER SER A . n A 1 96 GLU 96 92 92 GLU GLU A . n A 1 97 THR 97 93 93 THR THR A . n A 1 98 LEU 98 94 94 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-04-21 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -137.94 -62.98 2 1 LYS A 16 ? ? -176.56 -64.99 3 1 ASP A 17 ? ? -92.92 51.63 4 1 SER A 18 ? ? -139.01 -79.87 5 1 LYS A 19 ? ? -177.41 -60.65 6 1 HIS A 26 ? ? 76.54 -4.91 7 1 HIS A 27 ? ? -179.26 37.27 8 1 LEU A 32 ? ? -105.41 43.63 9 1 ARG A 47 ? ? -159.70 36.30 10 1 ALA A 50 ? ? -176.07 -40.11 11 1 ASP A 53 ? ? 60.07 83.82 12 1 ASP A 60 ? ? -61.84 -173.68 13 1 SER A 64 ? ? 60.41 72.49 14 1 THR A 65 ? ? 50.44 -167.20 15 1 ASP A 66 ? ? -63.41 92.07 16 1 LEU A 70 ? ? -90.71 51.85 17 1 LYS A 72 ? ? -176.89 -38.78 18 1 TYR A 74 ? ? -144.71 17.17 19 1 LYS A 86 ? ? -160.08 29.03 20 1 ILE A 87 ? ? -120.77 -67.60 21 1 ALA A 88 ? ? -90.41 -72.55 22 1 GLU A 92 ? ? -176.19 99.28 23 2 LYS A 16 ? ? -176.85 87.68 24 2 ASP A 17 ? ? -152.42 -76.98 25 2 SER A 18 ? ? -179.02 39.74 26 2 LYS A 19 ? ? -139.56 -48.39 27 2 LEU A 25 ? ? -113.09 -78.32 28 2 LEU A 32 ? ? -112.58 62.45 29 2 PRO A 40 ? ? -85.88 48.60 30 2 GLU A 44 ? ? -90.05 45.89 31 2 LEU A 46 ? ? 55.04 -88.25 32 2 ALA A 50 ? ? 60.40 104.84 33 2 ASP A 53 ? ? -173.55 140.59 34 2 ALA A 54 ? ? 59.88 92.26 35 2 GLU A 56 ? ? -176.06 -39.82 36 2 GLU A 59 ? ? 60.50 164.19 37 2 ASP A 60 ? ? -120.76 -53.90 38 2 HIS A 63 ? ? -95.44 -72.98 39 2 ALA A 67 ? ? -75.83 -167.12 40 2 GLU A 69 ? ? -176.46 115.06 41 2 SER A 71 ? ? -53.11 93.52 42 2 LYS A 72 ? ? 179.31 -37.67 43 2 TYR A 74 ? ? -146.10 26.26 44 2 ARG A 84 ? ? -82.42 -74.26 45 2 LYS A 86 ? ? -176.56 -50.83 46 2 THR A 93 ? ? -176.39 36.88 47 3 HIS A 15 ? ? -79.92 -86.38 48 3 ASP A 17 ? ? -82.87 -90.84 49 3 SER A 18 ? ? 174.54 -54.12 50 3 GLU A 43 ? ? -115.27 -160.01 51 3 GLU A 44 ? ? -100.06 55.90 52 3 GLN A 49 ? ? -109.17 -166.38 53 3 ALA A 50 ? ? -158.86 -44.86 54 3 ALA A 54 ? ? 63.79 -88.96 55 3 THR A 55 ? ? -153.26 29.70 56 3 PHE A 58 ? ? -97.65 37.98 57 3 GLU A 59 ? ? -176.14 83.89 58 3 ASP A 60 ? ? -96.03 -67.41 59 3 SER A 64 ? ? -112.60 -76.42 60 3 THR A 65 ? ? 50.57 -90.31 61 3 ASP A 66 ? ? -148.45 -54.31 62 3 ARG A 68 ? ? -95.54 -67.17 63 3 SER A 85 ? ? -80.95 -83.90 64 3 LYS A 86 ? ? 178.39 38.71 65 3 ILE A 87 ? ? -109.57 -66.93 66 3 SER A 91 ? ? -161.14 85.59 67 3 GLU A 92 ? ? -157.48 31.11 68 4 LYS A 16 ? ? -112.82 -165.29 69 4 ASP A 17 ? ? -97.64 37.29 70 4 LEU A 25 ? ? -154.62 77.59 71 4 HIS A 26 ? ? 58.17 71.86 72 4 HIS A 27 ? ? 59.81 70.66 73 4 LEU A 32 ? ? -99.16 44.22 74 4 GLU A 43 ? ? 61.81 -89.19 75 4 GLU A 44 ? ? -100.57 66.02 76 4 ARG A 47 ? ? -124.01 -69.07 77 4 ALA A 54 ? ? 59.71 166.02 78 4 SER A 64 ? ? -173.61 124.40 79 4 THR A 65 ? ? 54.24 178.70 80 4 ARG A 68 ? ? -139.73 -46.20 81 4 GLU A 69 ? ? -176.45 98.92 82 4 LEU A 70 ? ? -90.26 51.57 83 4 LYS A 86 ? ? -179.65 -37.72 84 4 LYS A 89 ? ? 61.94 157.21 85 4 GLU A 92 ? ? 60.54 163.14 86 4 THR A 93 ? ? -162.01 115.12 87 5 LYS A 16 ? ? -108.94 -69.13 88 5 ASP A 17 ? ? -179.13 37.82 89 5 HIS A 26 ? ? 61.77 93.99 90 5 LYS A 28 ? ? -177.57 147.70 91 5 LEU A 32 ? ? -104.98 45.54 92 5 GLU A 43 ? ? -102.84 -90.22 93 5 VAL A 45 ? ? 42.85 -165.30 94 5 GLN A 49 ? ? -177.79 -38.83 95 5 ALA A 50 ? ? 60.20 101.04 96 5 GLU A 59 ? ? 59.28 168.07 97 5 SER A 64 ? ? -163.47 -61.04 98 5 ASP A 66 ? ? -63.34 -172.97 99 5 ARG A 68 ? ? -151.71 -45.68 100 5 GLU A 69 ? ? 65.16 129.24 101 5 SER A 71 ? ? -100.63 40.79 102 5 LYS A 72 ? ? -130.03 -38.92 103 5 SER A 85 ? ? -90.11 -74.09 104 5 LYS A 86 ? ? -160.22 81.73 105 5 LYS A 89 ? ? 59.74 86.86 106 5 SER A 91 ? ? -175.42 95.31 107 6 ASP A 3 ? ? -63.45 -171.99 108 6 VAL A 4 ? ? -63.52 92.28 109 6 HIS A 15 ? ? -122.61 -83.41 110 6 LYS A 19 ? ? -144.49 -45.90 111 6 LEU A 25 ? ? -96.51 -79.02 112 6 HIS A 27 ? ? -174.76 35.76 113 6 LEU A 32 ? ? -98.82 32.11 114 6 GLU A 38 ? ? -124.12 -52.49 115 6 ALA A 50 ? ? -63.59 92.22 116 6 ASP A 53 ? ? -158.97 -51.52 117 6 ALA A 54 ? ? -100.91 -67.65 118 6 THR A 55 ? ? -118.89 -72.99 119 6 ASN A 57 ? ? -153.49 -73.34 120 6 THR A 65 ? ? -176.82 -39.75 121 6 ASP A 66 ? ? -130.97 -44.99 122 6 GLU A 69 ? ? 64.57 142.03 123 6 SER A 71 ? ? -65.14 92.07 124 6 LYS A 72 ? ? -174.54 -43.60 125 6 TYR A 74 ? ? -146.67 17.74 126 6 ASP A 83 ? ? -134.89 -54.20 127 6 ARG A 84 ? ? -90.40 46.68 128 6 SER A 85 ? ? -90.39 -75.77 129 6 LYS A 86 ? ? -176.53 36.97 130 6 SER A 91 ? ? 59.89 -176.47 131 6 GLU A 92 ? ? 59.77 -176.70 132 7 LYS A 14 ? ? -90.84 49.63 133 7 ASP A 17 ? ? -91.03 52.86 134 7 LYS A 19 ? ? 178.81 156.00 135 7 SER A 20 ? ? 49.61 93.77 136 7 HIS A 26 ? ? 58.76 79.99 137 7 GLU A 37 ? ? -140.44 21.47 138 7 GLU A 43 ? ? -62.79 -157.66 139 7 GLU A 44 ? ? -90.29 53.86 140 7 ARG A 47 ? ? 179.40 34.54 141 7 GLN A 49 ? ? -152.77 88.28 142 7 ALA A 50 ? ? -176.45 -72.92 143 7 ASP A 53 ? ? 60.57 105.72 144 7 THR A 55 ? ? -160.95 41.35 145 7 PHE A 58 ? ? -140.83 29.02 146 7 GLU A 59 ? ? -178.67 38.12 147 7 SER A 64 ? ? -176.68 -55.93 148 7 THR A 65 ? ? -149.21 -75.28 149 7 ASP A 66 ? ? -177.29 -78.48 150 7 ALA A 67 ? ? -90.39 51.29 151 7 SER A 71 ? ? -54.29 93.26 152 7 LYS A 72 ? ? -178.59 -39.80 153 7 ILE A 76 ? ? -131.56 -40.33 154 7 LYS A 86 ? ? -176.32 -51.84 155 8 LYS A 2 ? ? 60.23 166.56 156 8 THR A 8 ? ? 62.89 132.34 157 8 HIS A 15 ? ? -79.68 -80.42 158 8 SER A 20 ? ? -169.88 106.49 159 8 HIS A 27 ? ? 61.43 78.74 160 8 GLU A 43 ? ? -122.58 -71.52 161 8 VAL A 45 ? ? -72.05 -156.68 162 8 LEU A 46 ? ? -91.31 37.44 163 8 GLN A 49 ? ? 57.58 83.49 164 8 ASP A 53 ? ? -177.01 111.89 165 8 ALA A 54 ? ? -71.51 -74.51 166 8 THR A 55 ? ? -153.26 -45.59 167 8 ASN A 57 ? ? -177.19 -39.53 168 8 ASP A 60 ? ? -61.98 -173.48 169 8 HIS A 63 ? ? -108.08 -62.16 170 8 SER A 64 ? ? -162.32 30.88 171 8 ASP A 66 ? ? 61.73 -89.43 172 8 ARG A 68 ? ? 60.07 -175.66 173 8 SER A 71 ? ? -51.18 92.95 174 8 LYS A 72 ? ? -179.31 -41.16 175 8 TYR A 74 ? ? -142.23 22.32 176 8 ASP A 83 ? ? -130.75 -39.11 177 8 ARG A 84 ? ? -68.73 -95.91 178 8 ILE A 87 ? ? -144.55 -56.75 179 8 LYS A 89 ? ? 59.80 83.45 180 8 SER A 91 ? ? 59.84 165.70 181 8 THR A 93 ? ? -98.48 35.81 182 9 LYS A 14 ? ? -91.70 50.91 183 9 LYS A 16 ? ? 70.12 37.34 184 9 ASP A 17 ? ? -100.82 76.50 185 9 SER A 18 ? ? 61.36 96.41 186 9 LYS A 19 ? ? 60.10 165.60 187 9 SER A 20 ? ? 60.19 87.96 188 9 LEU A 25 ? ? -118.05 58.57 189 9 HIS A 26 ? ? 64.97 88.51 190 9 HIS A 39 ? ? -150.90 67.70 191 9 GLU A 43 ? ? -170.57 -172.19 192 9 GLU A 44 ? ? -90.16 54.69 193 9 VAL A 45 ? ? -58.81 -173.93 194 9 ALA A 50 ? ? -169.60 -56.41 195 9 ASN A 57 ? ? -177.12 -39.16 196 9 SER A 64 ? ? -177.64 -166.02 197 9 THR A 65 ? ? -166.11 -43.42 198 9 GLU A 69 ? ? 64.26 142.57 199 9 LEU A 70 ? ? -90.32 52.70 200 9 TYR A 74 ? ? -144.99 35.72 201 9 ARG A 84 ? ? -62.45 -164.60 202 9 LYS A 86 ? ? -176.66 -65.19 203 9 SER A 91 ? ? -176.58 115.75 204 9 GLU A 92 ? ? 60.65 163.14 205 10 LYS A 2 ? ? -175.98 88.72 206 10 THR A 8 ? ? 63.16 130.75 207 10 ASP A 17 ? ? -140.75 29.81 208 10 SER A 18 ? ? -160.90 -79.84 209 10 LYS A 19 ? ? -177.12 -65.87 210 10 GLU A 43 ? ? -137.34 -60.56 211 10 VAL A 45 ? ? -102.98 -162.59 212 10 LEU A 46 ? ? -57.20 92.20 213 10 ARG A 47 ? ? 177.88 -37.01 214 10 ALA A 50 ? ? -176.68 37.05 215 10 ASP A 53 ? ? -98.12 37.17 216 10 PHE A 58 ? ? -63.42 -73.39 217 10 HIS A 63 ? ? -164.49 -73.22 218 10 ARG A 68 ? ? 40.79 94.61 219 10 GLU A 69 ? ? 64.94 122.92 220 10 SER A 71 ? ? -56.69 92.23 221 10 LYS A 72 ? ? -178.57 -43.48 222 10 TYR A 74 ? ? -141.69 22.54 223 10 SER A 85 ? ? -62.47 98.54 224 10 LYS A 86 ? ? -176.37 36.78 225 10 SER A 91 ? ? -166.88 -73.28 226 10 GLU A 92 ? ? -176.66 -42.46 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 47 ? ? 0.242 'SIDE CHAIN' 2 1 ARG A 68 ? ? 0.266 'SIDE CHAIN' 3 1 ARG A 84 ? ? 0.235 'SIDE CHAIN' 4 2 ARG A 47 ? ? 0.233 'SIDE CHAIN' 5 2 ARG A 68 ? ? 0.317 'SIDE CHAIN' 6 2 ARG A 84 ? ? 0.287 'SIDE CHAIN' 7 3 ARG A 47 ? ? 0.318 'SIDE CHAIN' 8 3 ARG A 68 ? ? 0.295 'SIDE CHAIN' 9 3 ARG A 84 ? ? 0.302 'SIDE CHAIN' 10 4 ARG A 47 ? ? 0.305 'SIDE CHAIN' 11 4 ARG A 68 ? ? 0.219 'SIDE CHAIN' 12 4 ARG A 84 ? ? 0.253 'SIDE CHAIN' 13 5 ARG A 47 ? ? 0.299 'SIDE CHAIN' 14 5 ARG A 68 ? ? 0.249 'SIDE CHAIN' 15 5 ARG A 84 ? ? 0.247 'SIDE CHAIN' 16 6 ARG A 47 ? ? 0.256 'SIDE CHAIN' 17 6 ARG A 68 ? ? 0.243 'SIDE CHAIN' 18 6 ARG A 84 ? ? 0.233 'SIDE CHAIN' 19 7 ARG A 47 ? ? 0.242 'SIDE CHAIN' 20 7 ARG A 68 ? ? 0.249 'SIDE CHAIN' 21 7 ARG A 84 ? ? 0.223 'SIDE CHAIN' 22 8 ARG A 47 ? ? 0.261 'SIDE CHAIN' 23 8 ARG A 68 ? ? 0.318 'SIDE CHAIN' 24 8 ARG A 84 ? ? 0.317 'SIDE CHAIN' 25 9 ARG A 47 ? ? 0.298 'SIDE CHAIN' 26 9 ARG A 68 ? ? 0.315 'SIDE CHAIN' 27 9 ARG A 84 ? ? 0.214 'SIDE CHAIN' 28 10 ARG A 47 ? ? 0.235 'SIDE CHAIN' 29 10 ARG A 68 ? ? 0.261 'SIDE CHAIN' 30 10 ARG A 84 ? ? 0.232 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA -3 ? A ALA 1 2 1 Y 1 A GLU -2 ? A GLU 2 3 1 Y 1 A GLN -1 ? A GLN 3 4 1 Y 1 A SER 0 ? A SER 4 5 2 Y 1 A ALA -3 ? A ALA 1 6 2 Y 1 A GLU -2 ? A GLU 2 7 2 Y 1 A GLN -1 ? A GLN 3 8 2 Y 1 A SER 0 ? A SER 4 9 3 Y 1 A ALA -3 ? A ALA 1 10 3 Y 1 A GLU -2 ? A GLU 2 11 3 Y 1 A GLN -1 ? A GLN 3 12 3 Y 1 A SER 0 ? A SER 4 13 4 Y 1 A ALA -3 ? A ALA 1 14 4 Y 1 A GLU -2 ? A GLU 2 15 4 Y 1 A GLN -1 ? A GLN 3 16 4 Y 1 A SER 0 ? A SER 4 17 5 Y 1 A ALA -3 ? A ALA 1 18 5 Y 1 A GLU -2 ? A GLU 2 19 5 Y 1 A GLN -1 ? A GLN 3 20 5 Y 1 A SER 0 ? A SER 4 21 6 Y 1 A ALA -3 ? A ALA 1 22 6 Y 1 A GLU -2 ? A GLU 2 23 6 Y 1 A GLN -1 ? A GLN 3 24 6 Y 1 A SER 0 ? A SER 4 25 7 Y 1 A ALA -3 ? A ALA 1 26 7 Y 1 A GLU -2 ? A GLU 2 27 7 Y 1 A GLN -1 ? A GLN 3 28 7 Y 1 A SER 0 ? A SER 4 29 8 Y 1 A ALA -3 ? A ALA 1 30 8 Y 1 A GLU -2 ? A GLU 2 31 8 Y 1 A GLN -1 ? A GLN 3 32 8 Y 1 A SER 0 ? A SER 4 33 9 Y 1 A ALA -3 ? A ALA 1 34 9 Y 1 A GLU -2 ? A GLU 2 35 9 Y 1 A GLN -1 ? A GLN 3 36 9 Y 1 A SER 0 ? A SER 4 37 10 Y 1 A ALA -3 ? A ALA 1 38 10 Y 1 A GLU -2 ? A GLU 2 39 10 Y 1 A GLN -1 ? A GLN 3 40 10 Y 1 A SER 0 ? A SER 4 #