data_1IFP # _entry.id 1IFP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IFP pdb_00001ifp 10.2210/pdb1ifp/pdb WWPDB D_1000174139 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IFP _pdbx_database_status.recvd_initial_deposition_date 1998-01-22 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Welsh, L.C.' 1 'Symmons, M.F.' 2 'Perham, R.N.' 3 'Marvin, D.A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of the capsid of Pf3 filamentous phage determined from X-ray fibre diffraction data at 3.1 A resolution.' J.Mol.Biol. 283 155 177 1998 JMOBAK UK 0022-2836 0070 ? 9761681 10.1006/jmbi.1998.2081 1 ;Pf1 Filamentous Bacteriophage: Refinement of a Molecular Model by Simulated Annealing Using 3.3 A Resolution X-Ray Fibre Diffraction Data ; 'Acta Crystallogr.,Sect.D' 51 792 ? 1995 ABCRE6 DK 0907-4449 0766 ? ? ? 2 ;Two Forms of Pf1 Inovirus: X-Ray Diffraction Studies on a Structural Phase Transition and a Calculated Libration Normal Mode of the Asymmetric Unit ; 'Phase Transitions' 39 45 ? 1992 PHTRDP US 0141-1594 1101 ? ? ? 3 'Model-Building Studies of Inovirus: Genetic Variations on a Geometric Theme' Int.J.Biol.Macromol. 12 125 ? 1990 IJBMDR UK 0141-8130 0708 ? ? ? 4 'Erratum. Model-Building Studies of Inovirus: Genetic Variations on a Geometric Theme' Int.J.Biol.Macromol. 12 335 ? 1990 IJBMDR UK 0141-8130 0708 ? ? ? 5 'Dynamics of Telescoping Inovirus: A Mechanism for Assembly at Membrane Adhesions' Int.J.Biol.Macromol. 11 159 ? 1989 IJBMDR UK 0141-8130 0708 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Welsh, L.C.' 1 ? primary 'Symmons, M.F.' 2 ? primary 'Sturtevant, J.M.' 3 ? primary 'Marvin, D.A.' 4 ? primary 'Perham, R.N.' 5 ? 1 'Gonzalez, A.' 6 ? 1 'Nave, C.' 7 ? 1 'Marvin, D.A.' 8 ? 2 'Marvin, D.A.' 9 ? 2 'Nave, C.' 10 ? 2 'Bansal, M.' 11 ? 2 'Hale, R.D.' 12 ? 2 'Salje, E.K.H.' 13 ? 3 'Marvin, D.A.' 14 ? 4 'Marvin, D.A.' 15 ? 5 'Marvin, D.A.' 16 ? # _cell.entry_id 1IFP _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1IFP _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MAJOR COAT PROTEIN ASSEMBLY' _entity.formula_weight 4632.466 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PF3 INOVIRUS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF _entity_poly.pdbx_seq_one_letter_code_can MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 SER n 1 4 VAL n 1 5 ILE n 1 6 THR n 1 7 ASP n 1 8 VAL n 1 9 THR n 1 10 GLY n 1 11 GLN n 1 12 LEU n 1 13 THR n 1 14 ALA n 1 15 VAL n 1 16 GLN n 1 17 ALA n 1 18 ASP n 1 19 ILE n 1 20 THR n 1 21 THR n 1 22 ILE n 1 23 GLY n 1 24 GLY n 1 25 ALA n 1 26 ILE n 1 27 ILE n 1 28 VAL n 1 29 LEU n 1 30 ALA n 1 31 ALA n 1 32 VAL n 1 33 VAL n 1 34 LEU n 1 35 GLY n 1 36 ILE n 1 37 ARG n 1 38 TRP n 1 39 ILE n 1 40 LYS n 1 41 ALA n 1 42 GLN n 1 43 PHE n 1 44 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Inovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'NEW YORK' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas phage Pf3' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10872 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 287 _entity_src_gen.host_org_genus Pseudomonas _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'FILAMENTOUS BACTERIOPHAGE' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COAT1_BPPF3 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03623 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IFP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 44 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03623 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 44 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 44 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1IFP _exptl.method 'FIBER DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.0' # _diffrn.id 1 _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1995-12 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GE(111)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.488 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SRS BEAMLINE PX7.2' _diffrn_source.pdbx_synchrotron_site SRS _diffrn_source.pdbx_synchrotron_beamline PX7.2 _diffrn_source.pdbx_wavelength 1.488 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1IFP _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 60.0 _reflns.d_resolution_high 3.1 _reflns.number_obs ? _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1IFP _refine.ls_number_reflns_obs 1734 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 12.0 _refine.ls_d_res_high 3.1 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.17 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17 _refine.ls_R_factor_R_free 0.39 _refine.ls_R_factor_R_free_error 0.01 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 12.2 _refine.ls_number_reflns_R_free 211 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 19.0 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method 'A POSTERIORI' _refine.details ;MODEL REFINED WITH A VERSION OF X-PLOR 3.1 MODIFIED FOR USE WITH FIBRE DIFFRACTION DATA BY WANG & STUBBS (1993) ACTA CRYST. A49, 504-513. ; _refine.pdbx_starting_model 1IFN _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'FIBER DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 326 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 326 _refine_hist.d_res_high 3.1 _refine_hist.d_res_low 12.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.017 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.4 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 16.1 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 2.4 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_restr_ncs.dom_id 1 _refine_ls_restr_ncs.ncs_model_details 'STRICT NCS WAS IMPOSED ON THE MODEL THROUGHOUT THE REFINEMENT.' _refine_ls_restr_ncs.rms_dev_position ? _refine_ls_restr_ncs.weight_position ? _refine_ls_restr_ncs.rms_dev_B_iso ? _refine_ls_restr_ncs.weight_B_iso ? _refine_ls_restr_ncs.pdbx_type . _refine_ls_restr_ncs.pdbx_ens_id 1 _refine_ls_restr_ncs.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_restr_ncs.pdbx_ordinal 1 _refine_ls_restr_ncs.pdbx_auth_asym_id . _refine_ls_restr_ncs.pdbx_number ? _refine_ls_restr_ncs.pdbx_asym_id ? _refine_ls_restr_ncs.pdbx_rms ? _refine_ls_restr_ncs.pdbx_weight ? # _refine_ls_shell.pdbx_total_number_of_bins_used 4 _refine_ls_shell.d_res_high 3.10 _refine_ls_shell.d_res_low 3.43 _refine_ls_shell.number_reflns_R_work 112 _refine_ls_shell.R_factor_R_work 0.251 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 ? TOPH19.PEP 'X-RAY DIFFRACTION' # _struct_ncs_dom.id 1 _struct_ncs_dom.pdbx_ens_id 1 _struct_ncs_dom.details ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 1IFP _struct.title 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF3 MAJOR COAT PROTEIN ASSEMBLY' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IFP _struct_keywords.pdbx_keywords VIRUS _struct_keywords.text 'VIRUS COAT PROTEIN, Helical virus, Virus' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 42 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 2 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 42 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 41 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1IFP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IFP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 PHE 44 44 44 PHE PHE A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'representative helical assembly' ? helical 35 2 'helical asymmetric unit' ? monomeric 1 3 'helical asymmetric unit, std helical frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-35)' A 2 1 A 3 H A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] H 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1 'helical symmetry operation' ? ? 0.80552512 0.59256162 0.00000000 0.00000 -0.59256162 0.80552512 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -49.30000 2 'helical symmetry operation' ? ? 0.87183001 -0.48980857 0.00000000 0.00000 0.48980857 0.87183001 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -46.40000 3 'helical symmetry operation' ? ? -0.08706881 -0.99620230 0.00000000 0.00000 0.99620230 -0.08706881 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -43.50000 4 'helical symmetry operation' ? ? -0.94358154 -0.33114027 0.00000000 0.00000 0.33114027 -0.94358154 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -40.60000 5 'helical symmetry operation' ? ? -0.69051640 0.72331674 0.00000000 0.00000 -0.72331674 -0.69051640 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -37.70000 6 'helical symmetry operation' ? ? 0.37454186 0.92721000 0.00000000 0.00000 -0.92721000 0.37454186 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -34.80000 7 'helical symmetry operation' ? ? 0.99916827 0.04077704 0.00000000 0.00000 -0.04077704 0.99916827 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -31.90000 8 'helical symmetry operation' ? ? 0.44885117 -0.89360653 0.00000000 0.00000 0.89360653 0.44885117 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -29.00000 9 'helical symmetry operation' ? ? -0.62927970 -0.77717891 0.00000000 0.00000 0.77717891 -0.62927970 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -26.10000 10 'helical symmetry operation' ? ? -0.96742700 0.25315014 0.00000000 0.00000 -0.25315014 -0.96742700 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -23.20000 11 'helical symmetry operation' ? ? -0.16795604 0.98579449 0.00000000 0.00000 -0.98579449 -0.16795604 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -20.30000 12 'helical symmetry operation' ? ? 0.82901805 0.55922184 0.00000000 0.00000 -0.55922184 0.82901805 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -17.40000 13 'helical symmetry operation' ? ? 0.85113194 -0.52495182 0.00000000 0.00000 0.52495182 0.85113194 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -14.50000 14 'helical symmetry operation' ? ? -0.12761857 -0.99182332 0.00000000 0.00000 0.99182332 -0.12761857 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -11.60000 15 'helical symmetry operation' ? ? -0.95629965 -0.29238840 0.00000000 0.00000 0.29238840 -0.95629965 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -8.70000 16 'helical symmetry operation' ? ? -0.66044736 0.75087235 0.00000000 0.00000 -0.75087235 -0.66044736 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -5.80000 17 'helical symmetry operation' ? ? 0.41203922 0.91116611 0.00000000 0.00000 -0.91116611 0.41203922 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -2.90000 18 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -0.00000 19 'helical symmetry operation' ? ? 0.41203922 -0.91116611 0.00000000 0.00000 0.91116611 0.41203922 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 2.90000 20 'helical symmetry operation' ? ? -0.66044736 -0.75087235 0.00000000 0.00000 0.75087235 -0.66044736 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 5.80000 21 'helical symmetry operation' ? ? -0.95629965 0.29238840 0.00000000 0.00000 -0.29238840 -0.95629965 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 8.70000 22 'helical symmetry operation' ? ? -0.12761857 0.99182332 0.00000000 0.00000 -0.99182332 -0.12761857 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 11.60000 23 'helical symmetry operation' ? ? 0.85113194 0.52495182 0.00000000 0.00000 -0.52495182 0.85113194 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 14.50000 24 'helical symmetry operation' ? ? 0.82901805 -0.55922184 0.00000000 0.00000 0.55922184 0.82901805 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 17.40000 25 'helical symmetry operation' ? ? -0.16795604 -0.98579449 0.00000000 0.00000 0.98579449 -0.16795604 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 20.30000 26 'helical symmetry operation' ? ? -0.96742700 -0.25315014 0.00000000 0.00000 0.25315014 -0.96742700 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 23.20000 27 'helical symmetry operation' ? ? -0.62927970 0.77717891 0.00000000 0.00000 -0.77717891 -0.62927970 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 26.10000 28 'helical symmetry operation' ? ? 0.44885117 0.89360653 0.00000000 0.00000 -0.89360653 0.44885117 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 29.00000 29 'helical symmetry operation' ? ? 0.99916827 -0.04077704 0.00000000 0.00000 0.04077704 0.99916827 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 31.90000 30 'helical symmetry operation' ? ? 0.37454186 -0.92721000 0.00000000 0.00000 0.92721000 0.37454186 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 34.80000 31 'helical symmetry operation' ? ? -0.69051640 -0.72331674 0.00000000 0.00000 0.72331674 -0.69051640 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 37.70000 32 'helical symmetry operation' ? ? -0.94358154 0.33114027 0.00000000 0.00000 -0.33114027 -0.94358154 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 40.60000 33 'helical symmetry operation' ? ? -0.08706881 0.99620230 0.00000000 0.00000 -0.99620230 -0.08706881 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 43.50000 34 'helical symmetry operation' ? ? 0.87183001 0.48980857 0.00000000 0.00000 -0.48980857 0.87183001 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 46.40000 35 'helical symmetry operation' ? ? 0.80552512 -0.59256162 0.00000000 0.00000 0.59256162 0.80552512 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 49.30000 # _pdbx_helical_symmetry.entry_id 1IFP _pdbx_helical_symmetry.number_of_operations 35 _pdbx_helical_symmetry.rotation_per_n_subunits 65.667000 _pdbx_helical_symmetry.rise_per_n_subunits 2.900000 _pdbx_helical_symmetry.n_subunits_divisor 1 _pdbx_helical_symmetry.dyad_axis no _pdbx_helical_symmetry.circular_symmetry 1 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-11-04 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_initial_refinement_model 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_oper_list.name' 5 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 4 'Structure model' '_pdbx_struct_oper_list.type' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 CCP13 'data reduction' '(LSQINT)' ? 3 CCP13-FDSCALE 'data scaling' . ? 4 X-PLOR phasing . ? 5 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1IFN _pdbx_initial_refinement_model.details ? #