data_1IIJ # _entry.id 1IIJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IIJ pdb_00001iij 10.2210/pdb1iij/pdb RCSB RCSB013300 ? ? WWPDB D_1000013300 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IIJ _pdbx_database_status.recvd_initial_deposition_date 2001-04-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goetz, M.' 1 'Carlotti, C.' 2 'Bontems, F.' 3 'Dufourc, E.J.' 4 # _citation.id primary _citation.title ;Evidence for an alpha-helix --> pi-bulge helicity modulation for the neu/erbB-2 membrane-spanning segment. A 1H NMR and circular dichroism study. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 40 _citation.page_first 6534 _citation.page_last 6540 _citation.year 2001 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11371217 _citation.pdbx_database_id_DOI 10.1021/bi0027938 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goetz, M.' 1 ? primary 'Carlotti, C.' 2 ? primary 'Bontems, F.' 3 ? primary 'Dufourc, E.J.' 4 ? # _cell.entry_id 1IIJ _cell.length_a 1 _cell.length_b 1 _cell.length_c 1 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 90 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'ERBB-2 RECEPTOR PROTEIN-TYROSINE KINASE' _entity.formula_weight 3894.845 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.112 _entity.pdbx_mutation ? _entity.pdbx_fragment 'TRANSMEMBRANE DOMAIN, RESIDUES 650-684' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EQRASPVTFIIATVVGVLLFLILVVVVGILIKRRR _entity_poly.pdbx_seq_one_letter_code_can EQRASPVTFIIATVVGVLLFLILVVVVGILIKRRR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLN n 1 3 ARG n 1 4 ALA n 1 5 SER n 1 6 PRO n 1 7 VAL n 1 8 THR n 1 9 PHE n 1 10 ILE n 1 11 ILE n 1 12 ALA n 1 13 THR n 1 14 VAL n 1 15 VAL n 1 16 GLY n 1 17 VAL n 1 18 LEU n 1 19 LEU n 1 20 PHE n 1 21 LEU n 1 22 ILE n 1 23 LEU n 1 24 VAL n 1 25 VAL n 1 26 VAL n 1 27 VAL n 1 28 GLY n 1 29 ILE n 1 30 LEU n 1 31 ILE n 1 32 LYS n 1 33 ARG n 1 34 ARG n 1 35 ARG n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This peptide was chemically synthesized. This sequence occurs naturally in Rattus norvegicus (rat).' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ERBB2_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EQRASPVTFIIATVVGVLLFLILVVVVGILIKRRR _struct_ref.pdbx_align_begin 647 _struct_ref.pdbx_db_accession P06494 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IIJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06494 _struct_ref_seq.db_align_beg 647 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 681 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 1 2 '2D NOESY' 3 1 3 HOHAHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ATMOSPHERIC _pdbx_nmr_exptl_sample_conditions.pH ? _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5 mM neu-tm35 peptide' _pdbx_nmr_sample_details.solvent_system 'deuterated TFE' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 400 2 ? Bruker AVANCE 600 3 ? Bruker AVANCE 500 # _pdbx_nmr_refine.entry_id 1IIJ _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'Structures based 385 NOE restraints, 111 dihedral angles' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1IIJ _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1IIJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA ? 'structure solution' ? 1 Discover 'Ver. 97.0' 'structure solution' ? 2 XwinNMR ? collection ? 3 Discover 'Ver. 97.0' refinement ? 4 # _exptl.entry_id 1IIJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1IIJ _struct.title 'SOLUTION STRUCTURE OF THE NEU/ERBB-2 MEMBRANE SPANNING SEGMENT' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IIJ _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'alpha-helix-pi-bulge-alpha-helix, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 3 ? VAL A 24 ? ARG A 3 VAL A 24 1 ? 22 HELX_P HELX_P2 2 GLY A 28 ? ARG A 34 ? GLY A 28 ARG A 34 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1IIJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IIJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ARG 35 35 35 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-06-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 1 ? ? OE2 A GLU 1 ? ? 1.360 1.252 0.108 0.011 N 2 1 C A ARG 35 ? ? OXT A ARG 35 ? ? 1.366 1.229 0.137 0.019 N 3 2 CD A GLU 1 ? ? OE2 A GLU 1 ? ? 1.359 1.252 0.107 0.011 N 4 2 C A ARG 35 ? ? OXT A ARG 35 ? ? 1.363 1.229 0.134 0.019 N 5 3 CD A GLU 1 ? ? OE2 A GLU 1 ? ? 1.359 1.252 0.107 0.011 N 6 3 C A ARG 35 ? ? OXT A ARG 35 ? ? 1.364 1.229 0.135 0.019 N 7 4 CD A GLU 1 ? ? OE2 A GLU 1 ? ? 1.359 1.252 0.107 0.011 N 8 4 C A ARG 35 ? ? OXT A ARG 35 ? ? 1.366 1.229 0.137 0.019 N 9 5 CD A GLU 1 ? ? OE2 A GLU 1 ? ? 1.360 1.252 0.108 0.011 N 10 5 C A ARG 35 ? ? OXT A ARG 35 ? ? 1.366 1.229 0.137 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH1 A ARG 3 ? ? 124.51 120.30 4.21 0.50 N 2 1 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH2 A ARG 3 ? ? 117.29 120.30 -3.01 0.50 N 3 1 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 124.40 120.30 4.10 0.50 N 4 1 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH2 A ARG 33 ? ? 117.25 120.30 -3.05 0.50 N 5 1 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 124.31 120.30 4.01 0.50 N 6 1 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 124.81 120.30 4.51 0.50 N 7 1 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 117.13 120.30 -3.17 0.50 N 8 2 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH1 A ARG 3 ? ? 124.71 120.30 4.41 0.50 N 9 2 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH2 A ARG 3 ? ? 117.22 120.30 -3.08 0.50 N 10 2 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 124.99 120.30 4.69 0.50 N 11 2 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 124.45 120.30 4.15 0.50 N 12 2 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 124.58 120.30 4.28 0.50 N 13 2 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 117.21 120.30 -3.09 0.50 N 14 3 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH1 A ARG 3 ? ? 124.49 120.30 4.19 0.50 N 15 3 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH2 A ARG 3 ? ? 117.28 120.30 -3.02 0.50 N 16 3 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 124.45 120.30 4.15 0.50 N 17 3 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH2 A ARG 33 ? ? 117.24 120.30 -3.06 0.50 N 18 3 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 124.42 120.30 4.12 0.50 N 19 3 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 124.39 120.30 4.09 0.50 N 20 4 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH1 A ARG 3 ? ? 124.68 120.30 4.38 0.50 N 21 4 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH2 A ARG 3 ? ? 117.25 120.30 -3.05 0.50 N 22 4 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 124.40 120.30 4.10 0.50 N 23 4 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 124.54 120.30 4.24 0.50 N 24 4 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH2 A ARG 34 ? ? 117.28 120.30 -3.02 0.50 N 25 4 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 124.55 120.30 4.25 0.50 N 26 5 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH1 A ARG 3 ? ? 124.50 120.30 4.20 0.50 N 27 5 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH2 A ARG 3 ? ? 117.26 120.30 -3.04 0.50 N 28 5 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 124.43 120.30 4.13 0.50 N 29 5 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 124.57 120.30 4.27 0.50 N 30 5 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 124.69 120.30 4.39 0.50 N 31 5 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 117.23 120.30 -3.07 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 ARG A 34 ? ? -106.71 76.21 2 3 SER A 5 ? ? -146.32 -64.52 3 3 LEU A 23 ? ? -93.01 -61.36 4 4 VAL A 26 ? ? -76.00 -73.91 #