data_1IJ3 # _entry.id 1IJ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IJ3 pdb_00001ij3 10.2210/pdb1ij3/pdb RCSB RCSB013319 ? ? WWPDB D_1000013319 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IJ3 _pdbx_database_status.recvd_initial_deposition_date 2001-04-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Akey, D.L.' 1 'Malashkevich, V.N.' 2 'Kim, P.S.' 3 # _citation.id primary _citation.title 'Buried polar residues in coiled-coil interfaces.' _citation.journal_abbrev Biochemistry _citation.journal_volume 40 _citation.page_first 6352 _citation.page_last 6360 _citation.year 2001 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11371197 _citation.pdbx_database_id_DOI 10.1021/bi002829w # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Akey, D.L.' 1 ? primary 'Malashkevich, V.N.' 2 ? primary 'Kim, P.S.' 3 ? # _cell.entry_id 1IJ3 _cell.length_a 25.564 _cell.length_b 25.839 _cell.length_c 34.373 _cell.angle_alpha 86.47 _cell.angle_beta 84.49 _cell.angle_gamma 79.40 _cell.Z_PDB 3 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IJ3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'general control protein GCN4' 4004.677 3 ? N16S 'coiled coil region' ? 2 water nat water 18.015 113 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GCN4-PVLS # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)RMKQLEDKVEELLSKSYHLENEVARLKKLVGER' _entity_poly.pdbx_seq_one_letter_code_can XRMKQLEDKVEELLSKSYHLENEVARLKKLVGER _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ARG n 1 3 MET n 1 4 LYS n 1 5 GLN n 1 6 LEU n 1 7 GLU n 1 8 ASP n 1 9 LYS n 1 10 VAL n 1 11 GLU n 1 12 GLU n 1 13 LEU n 1 14 LEU n 1 15 SER n 1 16 LYS n 1 17 SER n 1 18 TYR n 1 19 HIS n 1 20 LEU n 1 21 GLU n 1 22 ASN n 1 23 GLU n 1 24 VAL n 1 25 ALA n 1 26 ARG n 1 27 LEU n 1 28 LYS n 1 29 LYS n 1 30 LEU n 1 31 VAL n 1 32 GLY n 1 33 GLU n 1 34 ARG n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;THIS PROTEIN WAS CHEMICALLY SYNTHESIZED. IT IS NATURALLY FOUND IN SACCHAROMYCES CEREVISIAE (YEAST). The Peptide is a variant of the yeast GCN4 coiled coil region made by solid phase synthesis. ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GCN4_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RMKQLEDKVEELLSKNYHLENEVARLKKLVGER _struct_ref.pdbx_align_begin 249 _struct_ref.pdbx_db_accession P03069 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1IJ3 A 2 ? 34 ? P03069 249 ? 281 ? 1 33 2 1 1IJ3 B 2 ? 34 ? P03069 249 ? 281 ? 1 33 3 1 1IJ3 C 2 ? 34 ? P03069 249 ? 281 ? 1 33 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1IJ3 SER A 17 ? UNP P03069 ASN 264 'engineered mutation' 16 1 2 1IJ3 SER B 17 ? UNP P03069 ASN 264 'engineered mutation' 16 2 3 1IJ3 SER C 17 ? UNP P03069 ASN 264 'engineered mutation' 16 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1IJ3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.85 _exptl_crystal.density_percent_sol 33.43 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '0.1 M MES, 50 mM cesium chloride, 10% PEG 20000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.2830 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.2830 # _reflns.entry_id 1IJ3 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F -3.0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 1.80 _reflns.number_obs 7378 _reflns.number_all 7965 _reflns.percent_possible_obs 92.6 _reflns.pdbx_Rmerge_I_obs 0.0590000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.1 _reflns.B_iso_Wilson_estimate 24.7 _reflns.pdbx_redundancy 1.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 90.0 _reflns_shell.Rmerge_I_obs 0.1800000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.5 _reflns_shell.pdbx_redundancy 1.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1IJ3 _refine.ls_number_reflns_obs 7378 _refine.ls_number_reflns_all 7965 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF 336619.33 _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 92.4 _refine.ls_R_factor_obs 0.2200000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2200000 _refine.ls_R_factor_R_free 0.2690000 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.7 _refine.ls_number_reflns_R_free 719 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 31.7 _refine.aniso_B[1][1] 0.58 _refine.aniso_B[2][2] -1.31 _refine.aniso_B[3][3] 0.73 _refine.aniso_B[1][2] 0.78 _refine.aniso_B[1][3] 3.10 _refine.aniso_B[2][3] -4.23 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.626 _refine.solvent_model_param_bsol 188.4 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1IJ3 _refine_analyze.Luzzati_coordinate_error_obs 0.22 _refine_analyze.Luzzati_sigma_a_obs 0.16 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.28 _refine_analyze.Luzzati_sigma_a_free 0.18 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 805 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 918 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 15.3 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.90 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 1.80 _refine_ls_shell.d_res_low 1.86 _refine_ls_shell.number_reflns_R_work 615 _refine_ls_shell.R_factor_R_work 0.3700000 _refine_ls_shell.percent_reflns_obs 90.0 _refine_ls_shell.R_factor_R_free 0.3920000 _refine_ls_shell.R_factor_R_free_error 0.041 _refine_ls_shell.percent_reflns_R_free 12.8 _refine_ls_shell.number_reflns_R_free 90 _refine_ls_shell.number_reflns_obs 622 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1IJ3 _struct.title 'GCN4-pVSL Coiled-coil trimer with Serine at the a(16) position' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IJ3 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'GCN4 coiled coil, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 2 ? LYS A 28 ? ARG A 1 LYS A 27 1 ? 27 HELX_P HELX_P2 2 ARG B 2 ? VAL B 31 ? ARG B 1 VAL B 30 1 ? 30 HELX_P HELX_P3 3 ARG C 2 ? GLY C 32 ? ARG C 1 GLY C 31 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A ARG 2 N ? ? A ACE 0 A ARG 1 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? B ACE 1 C ? ? ? 1_555 B ARG 2 N ? ? B ACE 0 B ARG 1 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale3 covale both ? C ACE 1 C ? ? ? 1_555 C ARG 2 N ? ? C ACE 0 C ARG 1 1_555 ? ? ? ? ? ? ? 1.331 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1IJ3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IJ3 _atom_sites.fract_transf_matrix[1][1] 0.039118 _atom_sites.fract_transf_matrix[1][2] -0.007321 _atom_sites.fract_transf_matrix[1][3] -0.003448 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.039373 _atom_sites.fract_transf_matrix[2][3] -0.001769 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029257 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 ARG 2 1 1 ARG ARG A . n A 1 3 MET 3 2 2 MET MET A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 ASP 8 7 7 ASP ASP A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 SER 17 16 16 SER SER A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 HIS 19 18 18 HIS HIS A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 ALA 25 24 24 ALA ALA A . n A 1 26 ARG 26 25 25 ARG ARG A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 ARG 34 33 ? ? ? A . n B 1 1 ACE 1 0 0 ACE ACE B . n B 1 2 ARG 2 1 1 ARG ARG B . n B 1 3 MET 3 2 2 MET MET B . n B 1 4 LYS 4 3 3 LYS LYS B . n B 1 5 GLN 5 4 4 GLN GLN B . n B 1 6 LEU 6 5 5 LEU LEU B . n B 1 7 GLU 7 6 6 GLU GLU B . n B 1 8 ASP 8 7 7 ASP ASP B . n B 1 9 LYS 9 8 8 LYS LYS B . n B 1 10 VAL 10 9 9 VAL VAL B . n B 1 11 GLU 11 10 10 GLU GLU B . n B 1 12 GLU 12 11 11 GLU GLU B . n B 1 13 LEU 13 12 12 LEU LEU B . n B 1 14 LEU 14 13 13 LEU LEU B . n B 1 15 SER 15 14 14 SER SER B . n B 1 16 LYS 16 15 15 LYS LYS B . n B 1 17 SER 17 16 16 SER SER B . n B 1 18 TYR 18 17 17 TYR TYR B . n B 1 19 HIS 19 18 18 HIS HIS B . n B 1 20 LEU 20 19 19 LEU LEU B . n B 1 21 GLU 21 20 20 GLU GLU B . n B 1 22 ASN 22 21 21 ASN ASN B . n B 1 23 GLU 23 22 22 GLU GLU B . n B 1 24 VAL 24 23 23 VAL VAL B . n B 1 25 ALA 25 24 24 ALA ALA B . n B 1 26 ARG 26 25 25 ARG ARG B . n B 1 27 LEU 27 26 26 LEU LEU B . n B 1 28 LYS 28 27 27 LYS LYS B . n B 1 29 LYS 29 28 28 LYS LYS B . n B 1 30 LEU 30 29 29 LEU LEU B . n B 1 31 VAL 31 30 30 VAL VAL B . n B 1 32 GLY 32 31 31 GLY GLY B . n B 1 33 GLU 33 32 ? ? ? B . n B 1 34 ARG 34 33 ? ? ? B . n C 1 1 ACE 1 0 0 ACE ACE C . n C 1 2 ARG 2 1 1 ARG ARG C . n C 1 3 MET 3 2 2 MET MET C . n C 1 4 LYS 4 3 3 LYS LYS C . n C 1 5 GLN 5 4 4 GLN GLN C . n C 1 6 LEU 6 5 5 LEU LEU C . n C 1 7 GLU 7 6 6 GLU GLU C . n C 1 8 ASP 8 7 7 ASP ASP C . n C 1 9 LYS 9 8 8 LYS LYS C . n C 1 10 VAL 10 9 9 VAL VAL C . n C 1 11 GLU 11 10 10 GLU GLU C . n C 1 12 GLU 12 11 11 GLU GLU C . n C 1 13 LEU 13 12 12 LEU LEU C . n C 1 14 LEU 14 13 13 LEU LEU C . n C 1 15 SER 15 14 14 SER SER C . n C 1 16 LYS 16 15 15 LYS LYS C . n C 1 17 SER 17 16 16 SER SER C . n C 1 18 TYR 18 17 17 TYR TYR C . n C 1 19 HIS 19 18 18 HIS HIS C . n C 1 20 LEU 20 19 19 LEU LEU C . n C 1 21 GLU 21 20 20 GLU GLU C . n C 1 22 ASN 22 21 21 ASN ASN C . n C 1 23 GLU 23 22 22 GLU GLU C . n C 1 24 VAL 24 23 23 VAL VAL C . n C 1 25 ALA 25 24 24 ALA ALA C . n C 1 26 ARG 26 25 25 ARG ARG C . n C 1 27 LEU 27 26 26 LEU LEU C . n C 1 28 LYS 28 27 27 LYS LYS C . n C 1 29 LYS 29 28 28 LYS LYS C . n C 1 30 LEU 30 29 29 LEU LEU C . n C 1 31 VAL 31 30 30 VAL VAL C . n C 1 32 GLY 32 31 31 GLY GLY C . n C 1 33 GLU 33 32 ? ? ? C . n C 1 34 ARG 34 33 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 34 2 HOH TIP A . D 2 HOH 2 35 10 HOH TIP A . D 2 HOH 3 36 12 HOH TIP A . D 2 HOH 4 37 17 HOH TIP A . D 2 HOH 5 38 19 HOH TIP A . D 2 HOH 6 39 21 HOH TIP A . D 2 HOH 7 40 22 HOH TIP A . D 2 HOH 8 41 26 HOH TIP A . D 2 HOH 9 42 28 HOH TIP A . D 2 HOH 10 43 31 HOH TIP A . D 2 HOH 11 44 32 HOH TIP A . D 2 HOH 12 45 38 HOH TIP A . D 2 HOH 13 46 39 HOH TIP A . D 2 HOH 14 47 40 HOH TIP A . D 2 HOH 15 48 43 HOH TIP A . D 2 HOH 16 49 47 HOH TIP A . D 2 HOH 17 50 52 HOH TIP A . D 2 HOH 18 51 53 HOH TIP A . D 2 HOH 19 52 54 HOH TIP A . D 2 HOH 20 53 56 HOH TIP A . D 2 HOH 21 54 57 HOH TIP A . D 2 HOH 22 55 58 HOH TIP A . D 2 HOH 23 56 59 HOH TIP A . D 2 HOH 24 57 60 HOH TIP A . D 2 HOH 25 58 61 HOH TIP A . D 2 HOH 26 59 71 HOH TIP A . D 2 HOH 27 60 72 HOH TIP A . D 2 HOH 28 61 73 HOH TIP A . D 2 HOH 29 62 74 HOH TIP A . D 2 HOH 30 63 85 HOH TIP A . D 2 HOH 31 64 90 HOH TIP A . D 2 HOH 32 65 91 HOH TIP A . D 2 HOH 33 66 92 HOH TIP A . D 2 HOH 34 67 94 HOH TIP A . D 2 HOH 35 68 95 HOH TIP A . D 2 HOH 36 69 99 HOH TIP A . D 2 HOH 37 70 100 HOH TIP A . D 2 HOH 38 71 101 HOH TIP A . D 2 HOH 39 72 102 HOH TIP A . E 2 HOH 1 34 1 HOH TIP B . E 2 HOH 2 35 4 HOH TIP B . E 2 HOH 3 36 5 HOH TIP B . E 2 HOH 4 37 8 HOH TIP B . E 2 HOH 5 38 9 HOH TIP B . E 2 HOH 6 39 11 HOH TIP B . E 2 HOH 7 40 18 HOH TIP B . E 2 HOH 8 41 23 HOH TIP B . E 2 HOH 9 42 24 HOH TIP B . E 2 HOH 10 43 25 HOH TIP B . E 2 HOH 11 44 30 HOH TIP B . E 2 HOH 12 45 37 HOH TIP B . E 2 HOH 13 46 41 HOH TIP B . E 2 HOH 14 47 42 HOH TIP B . E 2 HOH 15 48 45 HOH TIP B . E 2 HOH 16 49 46 HOH TIP B . E 2 HOH 17 50 49 HOH TIP B . E 2 HOH 18 51 55 HOH TIP B . E 2 HOH 19 52 62 HOH TIP B . E 2 HOH 20 53 63 HOH TIP B . E 2 HOH 21 54 77 HOH TIP B . E 2 HOH 22 55 78 HOH TIP B . E 2 HOH 23 56 79 HOH TIP B . E 2 HOH 24 57 84 HOH TIP B . E 2 HOH 25 58 87 HOH TIP B . E 2 HOH 26 59 96 HOH TIP B . E 2 HOH 27 60 97 HOH TIP B . E 2 HOH 28 61 98 HOH TIP B . E 2 HOH 29 62 105 HOH TIP B . E 2 HOH 30 63 106 HOH TIP B . E 2 HOH 31 64 107 HOH TIP B . E 2 HOH 32 65 108 HOH TIP B . F 2 HOH 1 34 3 HOH TIP C . F 2 HOH 2 35 6 HOH TIP C . F 2 HOH 3 36 7 HOH TIP C . F 2 HOH 4 37 13 HOH TIP C . F 2 HOH 5 38 14 HOH TIP C . F 2 HOH 6 39 15 HOH TIP C . F 2 HOH 7 40 16 HOH TIP C . F 2 HOH 8 41 20 HOH TIP C . F 2 HOH 9 42 27 HOH TIP C . F 2 HOH 10 43 29 HOH TIP C . F 2 HOH 11 44 33 HOH TIP C . F 2 HOH 12 45 34 HOH TIP C . F 2 HOH 13 46 35 HOH TIP C . F 2 HOH 14 47 36 HOH TIP C . F 2 HOH 15 48 44 HOH TIP C . F 2 HOH 16 49 48 HOH TIP C . F 2 HOH 17 50 50 HOH TIP C . F 2 HOH 18 51 51 HOH TIP C . F 2 HOH 19 52 64 HOH TIP C . F 2 HOH 20 53 65 HOH TIP C . F 2 HOH 21 54 66 HOH TIP C . F 2 HOH 22 55 67 HOH TIP C . F 2 HOH 23 56 68 HOH TIP C . F 2 HOH 24 57 69 HOH TIP C . F 2 HOH 25 58 70 HOH TIP C . F 2 HOH 26 59 75 HOH TIP C . F 2 HOH 27 60 76 HOH TIP C . F 2 HOH 28 61 81 HOH TIP C . F 2 HOH 29 62 82 HOH TIP C . F 2 HOH 30 63 83 HOH TIP C . F 2 HOH 31 64 86 HOH TIP C . F 2 HOH 32 65 88 HOH TIP C . F 2 HOH 33 66 89 HOH TIP C . F 2 HOH 34 67 93 HOH TIP C . F 2 HOH 35 68 103 HOH TIP C . F 2 HOH 36 69 104 HOH TIP C . F 2 HOH 37 70 109 HOH TIP C . F 2 HOH 38 71 110 HOH TIP C . F 2 HOH 39 72 111 HOH TIP C . F 2 HOH 40 73 112 HOH TIP C . F 2 HOH 41 74 113 HOH TIP C . F 2 HOH 42 75 114 HOH TIP C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4100 ? 1 MORE -39 ? 1 'SSA (A^2)' 6470 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-08-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 CNS refinement 0.5 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 C _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 25 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 C _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 25 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 C _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 25 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.88 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.58 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 29 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -78.64 _pdbx_validate_torsion.psi 44.67 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLU 10 ? CD ? A GLU 11 CD 2 1 Y 0 A GLU 10 ? OE1 ? A GLU 11 OE1 3 1 Y 0 A GLU 10 ? OE2 ? A GLU 11 OE2 4 1 Y 0 A GLU 32 ? C ? A GLU 33 C 5 1 Y 0 B GLU 10 ? CD ? B GLU 11 CD 6 1 Y 0 B GLU 10 ? OE1 ? B GLU 11 OE1 7 1 Y 0 B GLU 10 ? OE2 ? B GLU 11 OE2 8 1 Y 0 C LYS 3 ? CD ? C LYS 4 CD 9 1 Y 0 C LYS 3 ? CE ? C LYS 4 CE 10 1 Y 0 C LYS 3 ? NZ ? C LYS 4 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 33 ? A ARG 34 2 1 Y 1 B GLU 32 ? B GLU 33 3 1 Y 1 B ARG 33 ? B ARG 34 4 1 Y 1 C GLU 32 ? C GLU 33 5 1 Y 1 C ARG 33 ? C ARG 34 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #