data_1IMZ
# 
_entry.id   1IMZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IMZ         
WWPDB D_1000174204 
# 
_pdbx_database_PDB_obs_spr.id               OBSLTE 
_pdbx_database_PDB_obs_spr.date             2002-05-14 
_pdbx_database_PDB_obs_spr.pdb_id           1GXG 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1IMZ 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.entry_id                        1IMZ 
_pdbx_database_status.status_code                     OBS 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.recvd_initial_deposition_date   1997-01-30 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Videler, H.'    1 
'Boetzel, R.'    2 
'Osborne, M.J.'  3 
'Williams, G.'   4 
'Lian, L.Y.'     5 
'James, R.'      6 
'Kleanthous, C.' 7 
'Moore, G.R.'    8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Three-Dimensional Solution Structure and 13C NMR Assignments of the Colicin E9 Immunity Protein Im8' 'To be Published' ?  
?    ? ?    ?      ?  ?         0353 ? ? ? 
1       
'Three-Dimensional Solution Structure and 13C Nuclear Magnetic Resonance Assignments of the Colicin E9 Immunity Protein Im9' 
Biochemistry      35 9505 ? 1996 BICHAW US 0006-2960 0033 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Videler, H.'    1  
primary 'Boetzel, R.'    2  
primary 'Osborne, M.J.'  3  
primary 'Williams, G.'   4  
primary 'Lian, L.Y.'     5  
primary 'James, R.'      6  
primary 'Kleanthous, C.' 7  
primary 'Moore, G.R.'    8  
1       'Osborne, M.J.'  9  
1       'Breeze, A.L.'   10 
1       'Lian, L.Y.'     11 
1       'Reilly, A.'     12 
1       'James, R.'      13 
1       'Kleanthous, C.' 14 
1       'Moore, G.R.'    15 
# 
_cell.entry_id           1IMZ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IMZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       non-polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'COLICIN E8 IMMUNITY PROTEIN' 
_entity.formula_weight             9634.519 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        IM8 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'ESCHERICHIA COLI' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      ? 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     JM105 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IMM8_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P09881 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKS
GFKQG
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IMZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 85 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P09881 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  85 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       85 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1IMZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1IMZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1IMZ 
_struct.title                     'COLICIN E8 IMMUNITY PROTEIN IM8, NMR, MINIMIZED AVERAGE STRUCTURE' 
_struct.pdbx_descriptor           'COLICIN E8 IMMUNITY PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IMZ 
_struct_keywords.pdbx_keywords   BACTERIOCIN 
_struct_keywords.text            'BACTERIOCIN, COLICIN, DNASE INHIBITOR, IMMUNITY PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A . ? TYR A . ? SER A 8  TYR A 10 5 ? 3  
HELX_P HELX_P2 2 GLU A . ? VAL A . ? GLU A 14 VAL A 42 1 ? 29 
HELX_P HELX_P3 3 GLY A . ? TYR A . ? GLY A 48 TYR A 53 1 ? 6  
HELX_P HELX_P4 4 PRO A . ? ASN A . ? PRO A 55 ASN A 58 5 ? 4  
HELX_P HELX_P5 5 SER A . ? ASN A . ? SER A 62 ASN A 77 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1IMZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IMZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
A 1 MET 1  1  1  MET MET A . 
A 1 GLU 2  2  2  GLU GLU A . 
A 1 LEU 3  3  3  LEU LEU A . 
A 1 LYS 4  4  4  LYS LYS A . 
A 1 ASN 5  5  5  ASN ASN A . 
A 1 SER 6  6  6  SER SER A . 
A 1 ILE 7  7  7  ILE ILE A . 
A 1 SER 8  8  8  SER SER A . 
A 1 ASP 9  9  9  ASP ASP A . 
A 1 TYR 10 10 10 TYR TYR A . 
A 1 THR 11 11 11 THR THR A . 
A 1 GLU 12 12 12 GLU GLU A . 
A 1 THR 13 13 13 THR THR A . 
A 1 GLU 14 14 14 GLU GLU A . 
A 1 PHE 15 15 15 PHE PHE A . 
A 1 LYS 16 16 16 LYS LYS A . 
A 1 LYS 17 17 17 LYS LYS A . 
A 1 ILE 18 18 18 ILE ILE A . 
A 1 ILE 19 19 19 ILE ILE A . 
A 1 GLU 20 20 20 GLU GLU A . 
A 1 ASP 21 21 21 ASP ASP A . 
A 1 ILE 22 22 22 ILE ILE A . 
A 1 ILE 23 23 23 ILE ILE A . 
A 1 ASN 24 24 24 ASN ASN A . 
A 1 CYS 25 25 25 CYS CYS A . 
A 1 GLU 26 26 26 GLU GLU A . 
A 1 GLY 27 27 27 GLY GLY A . 
A 1 ASP 28 28 28 ASP ASP A . 
A 1 GLU 29 29 29 GLU GLU A . 
A 1 LYS 30 30 30 LYS LYS A . 
A 1 LYS 31 31 31 LYS LYS A . 
A 1 GLN 32 32 32 GLN GLN A . 
A 1 ASP 33 33 33 ASP ASP A . 
A 1 ASP 34 34 34 ASP ASP A . 
A 1 ASN 35 35 35 ASN ASN A . 
A 1 LEU 36 36 36 LEU LEU A . 
A 1 GLU 37 37 37 GLU GLU A . 
A 1 HIS 38 38 38 HIS HIS A . 
A 1 PHE 39 39 39 PHE PHE A . 
A 1 ILE 40 40 40 ILE ILE A . 
A 1 SER 41 41 41 SER SER A . 
A 1 VAL 42 42 42 VAL VAL A . 
A 1 THR 43 43 43 THR THR A . 
A 1 GLU 44 44 44 GLU GLU A . 
A 1 HIS 45 45 45 HIS HIS A . 
A 1 PRO 46 46 46 PRO PRO A . 
A 1 SER 47 47 47 SER SER A . 
A 1 GLY 48 48 48 GLY GLY A . 
A 1 SER 49 49 49 SER SER A . 
A 1 ASP 50 50 50 ASP ASP A . 
A 1 LEU 51 51 51 LEU LEU A . 
A 1 ILE 52 52 52 ILE ILE A . 
A 1 TYR 53 53 53 TYR TYR A . 
A 1 TYR 54 54 54 TYR TYR A . 
A 1 PRO 55 55 55 PRO PRO A . 
A 1 GLU 56 56 56 GLU GLU A . 
A 1 GLY 57 57 57 GLY GLY A . 
A 1 ASN 58 58 58 ASN ASN A . 
A 1 ASN 59 59 59 ASN ASN A . 
A 1 ASP 60 60 60 ASP ASP A . 
A 1 GLY 61 61 61 GLY GLY A . 
A 1 SER 62 62 62 SER SER A . 
A 1 PRO 63 63 63 PRO PRO A . 
A 1 GLU 64 64 64 GLU GLU A . 
A 1 ALA 65 65 65 ALA ALA A . 
A 1 VAL 66 66 66 VAL VAL A . 
A 1 ILE 67 67 67 ILE ILE A . 
A 1 LYS 68 68 68 LYS LYS A . 
A 1 GLU 69 69 69 GLU GLU A . 
A 1 ILE 70 70 70 ILE ILE A . 
A 1 LYS 71 71 71 LYS LYS A . 
A 1 GLU 72 72 72 GLU GLU A . 
A 1 TRP 73 73 73 TRP TRP A . 
A 1 ARG 74 74 74 ARG ARG A . 
A 1 ALA 75 75 75 ALA ALA A . 
A 1 ALA 76 76 76 ALA ALA A . 
A 1 ASN 77 77 77 ASN ASN A . 
A 1 GLY 78 78 78 GLY GLY A . 
A 1 LYS 79 79 79 LYS LYS A . 
A 1 SER 80 80 80 SER SER A . 
A 1 GLY 81 81 81 GLY GLY A . 
A 1 PHE 82 82 82 PHE PHE A . 
A 1 LYS 83 83 83 LYS LYS A . 
A 1 GLN 84 84 84 GLN GLN A . 
A 1 GLY 85 85 85 GLY GLY A . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-09-16 
2 'Structure model' 1 1 2002-05-14 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
1 1 'Structure model' repository 'Initial release' ? 
2 2 'Structure model' repository Obsolete          ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1   1 1HD2 A ASN 77 ? ? 1HD  A LYS 79 ? ? 0.25 
2   1 HB   A ILE 19 ? ? 1HD1 A ILE 52 ? ? 0.89 
3   1 HA   A ALA 75 ? ? 1HB  A SER 80 ? ? 0.94 
4   1 O    A ASP 50 ? ? 2HB  A TYR 54 ? ? 0.94 
5   1 O    A THR 43 ? ? H    A HIS 45 ? ? 0.99 
6   1 3HG2 A ILE 18 ? ? H    A ILE 19 ? ? 1.01 
7   1 O    A TYR 10 ? ? 1HB  A PHE 15 ? ? 1.02 
8   1 2HG1 A ILE 19 ? ? 1HG2 A ILE 52 ? ? 1.10 
9   1 CD2  A HIS 45 ? ? 3HD1 A LEU 51 ? ? 1.12 
10  1 HD2  A HIS 45 ? ? CD1  A LEU 51 ? ? 1.13 
11  1 O    A ILE 67 ? ? 2HD  A LYS 71 ? ? 1.13 
12  1 O    A GLU 64 ? ? 1HB  A LYS 68 ? ? 1.16 
13  1 HD2  A HIS 45 ? ? 2HG1 A ILE 70 ? ? 1.18 
14  1 ND2  A ASN 77 ? ? 1HD  A LYS 79 ? ? 1.19 
15  1 O    A ASN 35 ? ? 2HB  A PHE 39 ? ? 1.20 
16  1 1HG2 A ILE 70 ? ? H    A LYS 71 ? ? 1.21 
17  1 HD2  A HIS 45 ? ? 2HD1 A LEU 51 ? ? 1.21 
18  1 HE1  A HIS 45 ? ? OG   A SER 47 ? ? 1.21 
19  1 HD2  A HIS 45 ? ? 3HD1 A LEU 51 ? ? 1.22 
20  1 1HD2 A ASN 77 ? ? CD   A LYS 79 ? ? 1.28 
21  1 C    A ILE 18 ? ? N    A ILE 19 ? ? 1.30 
22  1 C    A GLY 27 ? ? N    A ASP 28 ? ? 1.30 
23  1 C    A HIS 38 ? ? N    A PHE 39 ? ? 1.30 
24  1 C    A LYS 79 ? ? N    A SER 80 ? ? 1.30 
25  1 C    A PHE 82 ? ? N    A LYS 83 ? ? 1.30 
26  1 C    A THR 11 ? ? N    A GLU 12 ? ? 1.30 
27  1 C    A ASP 9  ? ? N    A TYR 10 ? ? 1.30 
28  1 C    A ILE 7  ? ? N    A SER 8  ? ? 1.30 
29  1 C    A GLU 44 ? ? N    A HIS 45 ? ? 1.30 
30  1 C    A THR 43 ? ? N    A GLU 44 ? ? 1.30 
31  1 C    A GLU 56 ? ? N    A GLY 57 ? ? 1.30 
32  1 C    A SER 6  ? ? N    A ILE 7  ? ? 1.30 
33  1 C    A ASN 35 ? ? N    A LEU 36 ? ? 1.30 
34  1 C    A ALA 65 ? ? N    A VAL 66 ? ? 1.30 
35  1 C    A SER 62 ? ? N    A PRO 63 ? ? 1.30 
36  1 HE2  A TYR 10 ? ? HB   A VAL 42 ? ? 1.30 
37  1 C    A HIS 45 ? ? N    A PRO 46 ? ? 1.30 
38  1 C    A GLU 72 ? ? N    A TRP 73 ? ? 1.30 
39  1 C    A GLY 48 ? ? N    A SER 49 ? ? 1.30 
40  1 C    A GLY 61 ? ? N    A SER 62 ? ? 1.30 
41  1 C    A LYS 17 ? ? N    A ILE 18 ? ? 1.30 
42  1 C    A GLU 26 ? ? N    A GLY 27 ? ? 1.30 
43  1 C    A GLU 14 ? ? N    A PHE 15 ? ? 1.30 
44  1 C    A PHE 15 ? ? N    A LYS 16 ? ? 1.30 
45  1 C    A ASP 33 ? ? N    A ASP 34 ? ? 1.30 
46  1 C    A GLY 81 ? ? N    A PHE 82 ? ? 1.30 
47  1 C    A LEU 36 ? ? N    A GLU 37 ? ? 1.30 
48  1 C    A LEU 51 ? ? N    A ILE 52 ? ? 1.30 
49  1 C    A PRO 63 ? ? N    A GLU 64 ? ? 1.30 
50  1 C    A GLN 32 ? ? N    A ASP 33 ? ? 1.30 
51  1 C    A ILE 70 ? ? N    A LYS 71 ? ? 1.30 
52  1 C    A GLU 12 ? ? N    A THR 13 ? ? 1.30 
53  1 C    A PRO 55 ? ? N    A GLU 56 ? ? 1.30 
54  1 C    A GLU 29 ? ? N    A LYS 30 ? ? 1.30 
55  1 C    A LYS 68 ? ? N    A GLU 69 ? ? 1.30 
56  1 C    A GLY 78 ? ? N    A LYS 79 ? ? 1.31 
57  1 C    A ILE 19 ? ? N    A GLU 20 ? ? 1.31 
58  1 C    A CYS 25 ? ? N    A GLU 26 ? ? 1.31 
59  1 C    A ASN 5  ? ? N    A SER 6  ? ? 1.31 
60  1 C    A ASP 60 ? ? N    A GLY 61 ? ? 1.31 
61  1 C    A MET 1  ? ? N    A GLU 2  ? ? 1.31 
62  1 C    A GLU 64 ? ? N    A ALA 65 ? ? 1.31 
63  1 C    A LYS 4  ? ? N    A ASN 5  ? ? 1.31 
64  1 C    A ASN 77 ? ? N    A GLY 78 ? ? 1.31 
65  1 C    A ALA 75 ? ? N    A ALA 76 ? ? 1.31 
66  1 C    A GLY 57 ? ? N    A ASN 58 ? ? 1.31 
67  1 C    A ASP 34 ? ? N    A ASN 35 ? ? 1.31 
68  1 C    A GLU 2  ? ? N    A LEU 3  ? ? 1.31 
69  1 C    A ILE 23 ? ? N    A ASN 24 ? ? 1.31 
70  1 C    A TYR 54 ? ? N    A PRO 55 ? ? 1.31 
71  1 C    A TYR 53 ? ? N    A TYR 54 ? ? 1.31 
72  1 C    A PRO 46 ? ? N    A SER 47 ? ? 1.31 
73  1 C    A GLN 84 ? ? N    A GLY 85 ? ? 1.31 
74  1 C    A LYS 31 ? ? N    A GLN 32 ? ? 1.31 
75  1 C    A GLU 20 ? ? N    A ASP 21 ? ? 1.31 
76  1 C    A LYS 83 ? ? N    A GLN 84 ? ? 1.31 
77  1 C    A ILE 67 ? ? N    A LYS 68 ? ? 1.31 
78  1 C    A LEU 3  ? ? N    A LYS 4  ? ? 1.31 
79  1 C    A PHE 39 ? ? N    A ILE 40 ? ? 1.31 
80  1 C    A ASP 28 ? ? N    A GLU 29 ? ? 1.31 
81  1 C    A SER 80 ? ? N    A GLY 81 ? ? 1.31 
82  1 C    A ARG 74 ? ? N    A ALA 75 ? ? 1.31 
83  1 C    A ASN 58 ? ? N    A ASN 59 ? ? 1.31 
84  1 C    A SER 41 ? ? N    A VAL 42 ? ? 1.31 
85  1 C    A VAL 66 ? ? N    A ILE 67 ? ? 1.31 
86  1 C    A ASN 59 ? ? N    A ASP 60 ? ? 1.31 
87  1 C    A ASN 24 ? ? N    A CYS 25 ? ? 1.31 
88  1 C    A LYS 30 ? ? N    A LYS 31 ? ? 1.31 
89  1 C    A LYS 71 ? ? N    A GLU 72 ? ? 1.31 
90  1 C    A THR 13 ? ? N    A GLU 14 ? ? 1.31 
91  1 C    A ALA 76 ? ? N    A ASN 77 ? ? 1.31 
92  1 C    A GLU 69 ? ? N    A ILE 70 ? ? 1.31 
93  1 C    A ILE 52 ? ? N    A TYR 53 ? ? 1.31 
94  1 C    A VAL 42 ? ? N    A THR 43 ? ? 1.31 
95  1 C    A ILE 22 ? ? N    A ILE 23 ? ? 1.31 
96  1 C    A SER 8  ? ? N    A ASP 9  ? ? 1.31 
97  1 C    A ILE 40 ? ? N    A SER 41 ? ? 1.31 
98  1 C    A SER 49 ? ? N    A ASP 50 ? ? 1.31 
99  1 C    A ASP 50 ? ? N    A LEU 51 ? ? 1.31 
100 1 C    A TRP 73 ? ? N    A ARG 74 ? ? 1.31 
101 1 C    A SER 47 ? ? N    A GLY 48 ? ? 1.31 
102 1 C    A LYS 16 ? ? N    A LYS 17 ? ? 1.31 
103 1 C    A GLU 37 ? ? N    A HIS 38 ? ? 1.31 
104 1 C    A ASP 21 ? ? N    A ILE 22 ? ? 1.31 
105 1 C    A TYR 10 ? ? N    A THR 11 ? ? 1.31 
106 1 HZ   A PHE 15 ? ? 1HD1 A ILE 70 ? ? 1.31 
107 1 O    A HIS 45 ? ? H    A SER 47 ? ? 1.32 
108 1 O    A GLU 56 ? ? OD1  A ASN 59 ? ? 1.34 
109 1 O    A ASN 24 ? ? H    A GLU 26 ? ? 1.35 
110 1 O    A ASP 34 ? ? 2HB  A HIS 38 ? ? 1.36 
111 1 CZ3  A TRP 73 ? ? 2HG  A ARG 74 ? ? 1.40 
112 1 O    A SER 8  ? ? 2HB  A LYS 83 ? ? 1.41 
113 1 O    A ILE 70 ? ? HE3  A TRP 73 ? ? 1.42 
114 1 O    A SER 8  ? ? 1HG2 A THR 11 ? ? 1.43 
115 1 HA   A ILE 7  ? ? CD2  A TYR 10 ? ? 1.45 
116 1 CG1  A ILE 19 ? ? 1HG2 A ILE 52 ? ? 1.45 
117 1 O    A PRO 63 ? ? HB   A ILE 67 ? ? 1.48 
118 1 O    A ASP 28 ? ? H    A LYS 31 ? ? 1.50 
119 1 O    A ILE 7  ? ? HE1  A PHE 82 ? ? 1.51 
120 1 CE1  A HIS 45 ? ? 1HB  A SER 47 ? ? 1.53 
121 1 HH   A TYR 54 ? ? OG   A SER 62 ? ? 1.54 
122 1 O    A SER 47 ? ? H    A ASP 50 ? ? 1.54 
123 1 CD2  A HIS 45 ? ? 2HD1 A LEU 51 ? ? 1.57 
124 1 HA   A ALA 75 ? ? CB   A SER 80 ? ? 1.57 
125 1 O    A GLY 27 ? ? 2HD  A LYS 30 ? ? 1.57 
126 1 O    A ASP 9  ? ? 1HB  A GLU 14 ? ? 1.59 
127 1 O    A GLU 56 ? ? H    A ASN 59 ? ? 1.60 
128 1 CD2  A HIS 45 ? ? CD1  A LEU 51 ? ? 1.63 
129 1 O    A SER 6  ? ? CZ   A TYR 10 ? ? 1.65 
130 1 O    A SER 6  ? ? CE1  A TYR 10 ? ? 1.69 
131 1 O    A SER 8  ? ? CG2  A THR 11 ? ? 1.81 
132 1 O    A ASP 50 ? ? CB   A TYR 54 ? ? 1.82 
133 1 O    A THR 43 ? ? N    A HIS 45 ? ? 1.83 
134 1 CE1  A HIS 45 ? ? OG   A SER 47 ? ? 1.87 
135 1 O    A ASP 34 ? ? CB   A HIS 38 ? ? 1.90 
136 1 O    A ASN 35 ? ? CB   A PHE 39 ? ? 1.91 
137 1 O    A ASN 24 ? ? N    A GLU 26 ? ? 1.92 
138 1 ND2  A ASN 77 ? ? CD   A LYS 79 ? ? 1.93 
139 1 O    A ASP 9  ? ? CB   A GLU 14 ? ? 1.94 
140 1 C    A SER 6  ? ? CZ   A TYR 10 ? ? 1.98 
141 1 O    A GLU 56 ? ? CG   A ASN 59 ? ? 2.00 
142 1 CE1  A HIS 45 ? ? CB   A SER 47 ? ? 2.01 
143 1 NE2  A HIS 45 ? ? CD1  A LEU 51 ? ? 2.03 
144 1 O    A TYR 10 ? ? CB   A PHE 15 ? ? 2.03 
145 1 O    A ILE 67 ? ? CD   A LYS 71 ? ? 2.04 
146 1 O    A ILE 7  ? ? CE1  A PHE 82 ? ? 2.04 
147 1 O    A SER 80 ? ? N    A PHE 82 ? ? 2.05 
148 1 O    A TYR 10 ? ? O    A THR 11 ? ? 2.07 
149 1 O    A ASN 5  ? ? CB   A SER 6  ? ? 2.08 
150 1 O    A PRO 63 ? ? CB   A ILE 67 ? ? 2.09 
151 1 CA   A SER 6  ? ? OH   A TYR 10 ? ? 2.10 
152 1 O    A GLU 56 ? ? N    A ASN 58 ? ? 2.10 
153 1 C    A SER 6  ? ? OH   A TYR 10 ? ? 2.11 
154 1 O    A PRO 63 ? ? CG1  A ILE 67 ? ? 2.12 
155 1 O    A CYS 25 ? ? O    A GLU 26 ? ? 2.12 
156 1 O    A HIS 45 ? ? N    A SER 47 ? ? 2.14 
157 1 O    A TYR 10 ? ? CZ   A PHE 82 ? ? 2.16 
158 1 O    A LEU 3  ? ? CB   A LYS 4  ? ? 2.17 
159 1 O    A LEU 3  ? ? CG   A LYS 4  ? ? 2.17 
160 1 O    A ASP 50 ? ? N    A TYR 54 ? ? 2.17 
161 1 CG2  A ILE 18 ? ? N    A ILE 19 ? ? 2.19 
162 1 O    A SER 47 ? ? N    A GLY 48 ? ? 2.19 
163 1 O    A GLU 44 ? ? N    A HIS 45 ? ? 2.19 
164 1 O    A THR 11 ? ? N    A GLU 12 ? ? 2.19 
165 1 O    A ASN 35 ? ? N    A LEU 36 ? ? 2.19 
166 1 O    A ILE 7  ? ? N    A SER 8  ? ? 2.19 
167 1 O    A GLY 48 ? ? N    A SER 49 ? ? 2.19 
168 1 O    A ILE 19 ? ? N    A GLU 20 ? ? 2.19 
169 1 O    A GLU 14 ? ? N    A PHE 15 ? ? 2.19 
170 1 O    A GLU 56 ? ? N    A GLY 57 ? ? 2.19 
171 1 O    A CYS 25 ? ? N    A GLU 26 ? ? 2.19 
172 1 O    A GLU 26 ? ? N    A GLY 27 ? ? 2.19 
173 1 O    A ILE 22 ? ? N    A ILE 23 ? ? 2.19 
174 1 O    A LYS 79 ? ? N    A SER 80 ? ? 2.19 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     74 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.117 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 A MET 1  ? OXT ? A MET 1  OXT 
2  1 N 1 A GLU 2  ? OXT ? A GLU 2  OXT 
3  1 N 1 A LEU 3  ? OXT ? A LEU 3  OXT 
4  1 N 1 A LYS 4  ? OXT ? A LYS 4  OXT 
5  1 N 1 A ASN 5  ? OXT ? A ASN 5  OXT 
6  1 N 1 A SER 6  ? OXT ? A SER 6  OXT 
7  1 N 1 A ILE 7  ? OXT ? A ILE 7  OXT 
8  1 N 1 A SER 8  ? OXT ? A SER 8  OXT 
9  1 N 1 A ASP 9  ? OXT ? A ASP 9  OXT 
10 1 N 1 A TYR 10 ? OXT ? A TYR 10 OXT 
11 1 N 1 A THR 11 ? OXT ? A THR 11 OXT 
12 1 N 1 A GLU 12 ? OXT ? A GLU 12 OXT 
13 1 N 1 A THR 13 ? OXT ? A THR 13 OXT 
14 1 N 1 A GLU 14 ? OXT ? A GLU 14 OXT 
15 1 N 1 A PHE 15 ? OXT ? A PHE 15 OXT 
16 1 N 1 A LYS 16 ? OXT ? A LYS 16 OXT 
17 1 N 1 A LYS 17 ? OXT ? A LYS 17 OXT 
18 1 N 1 A ILE 18 ? OXT ? A ILE 18 OXT 
19 1 N 1 A ILE 19 ? OXT ? A ILE 19 OXT 
20 1 N 1 A GLU 20 ? OXT ? A GLU 20 OXT 
21 1 N 1 A ASP 21 ? OXT ? A ASP 21 OXT 
22 1 N 1 A ILE 22 ? OXT ? A ILE 22 OXT 
23 1 N 1 A ILE 23 ? OXT ? A ILE 23 OXT 
24 1 N 1 A ASN 24 ? OXT ? A ASN 24 OXT 
25 1 N 1 A CYS 25 ? OXT ? A CYS 25 OXT 
26 1 N 1 A GLU 26 ? OXT ? A GLU 26 OXT 
27 1 N 1 A GLY 27 ? OXT ? A GLY 27 OXT 
28 1 N 1 A ASP 28 ? OXT ? A ASP 28 OXT 
29 1 N 1 A GLU 29 ? OXT ? A GLU 29 OXT 
30 1 N 1 A LYS 30 ? OXT ? A LYS 30 OXT 
31 1 N 1 A LYS 31 ? OXT ? A LYS 31 OXT 
32 1 N 1 A GLN 32 ? OXT ? A GLN 32 OXT 
33 1 N 1 A ASP 33 ? OXT ? A ASP 33 OXT 
34 1 N 1 A ASP 34 ? OXT ? A ASP 34 OXT 
35 1 N 1 A ASN 35 ? OXT ? A ASN 35 OXT 
36 1 N 1 A LEU 36 ? OXT ? A LEU 36 OXT 
37 1 N 1 A GLU 37 ? OXT ? A GLU 37 OXT 
38 1 N 1 A HIS 38 ? OXT ? A HIS 38 OXT 
39 1 N 1 A PHE 39 ? OXT ? A PHE 39 OXT 
40 1 N 1 A ILE 40 ? OXT ? A ILE 40 OXT 
41 1 N 1 A SER 41 ? OXT ? A SER 41 OXT 
42 1 N 1 A VAL 42 ? OXT ? A VAL 42 OXT 
43 1 N 1 A THR 43 ? OXT ? A THR 43 OXT 
44 1 N 1 A GLU 44 ? OXT ? A GLU 44 OXT 
45 1 N 1 A HIS 45 ? OXT ? A HIS 45 OXT 
46 1 N 1 A PRO 46 ? OXT ? A PRO 46 OXT 
47 1 N 1 A SER 47 ? OXT ? A SER 47 OXT 
48 1 N 1 A GLY 48 ? OXT ? A GLY 48 OXT 
49 1 N 1 A SER 49 ? OXT ? A SER 49 OXT 
50 1 N 1 A ASP 50 ? OXT ? A ASP 50 OXT 
51 1 N 1 A LEU 51 ? OXT ? A LEU 51 OXT 
52 1 N 1 A ILE 52 ? OXT ? A ILE 52 OXT 
53 1 N 1 A TYR 53 ? OXT ? A TYR 53 OXT 
54 1 N 1 A TYR 54 ? OXT ? A TYR 54 OXT 
55 1 N 1 A PRO 55 ? OXT ? A PRO 55 OXT 
56 1 N 1 A GLU 56 ? OXT ? A GLU 56 OXT 
57 1 N 1 A GLY 57 ? OXT ? A GLY 57 OXT 
58 1 N 1 A ASN 58 ? OXT ? A ASN 58 OXT 
59 1 N 1 A ASN 59 ? OXT ? A ASN 59 OXT 
60 1 N 1 A ASP 60 ? OXT ? A ASP 60 OXT 
61 1 N 1 A GLY 61 ? OXT ? A GLY 61 OXT 
62 1 N 1 A SER 62 ? OXT ? A SER 62 OXT 
63 1 N 1 A PRO 63 ? OXT ? A PRO 63 OXT 
64 1 N 1 A GLU 64 ? OXT ? A GLU 64 OXT 
65 1 N 1 A ALA 65 ? OXT ? A ALA 65 OXT 
66 1 N 1 A VAL 66 ? OXT ? A VAL 66 OXT 
67 1 N 1 A ILE 67 ? OXT ? A ILE 67 OXT 
68 1 N 1 A LYS 68 ? OXT ? A LYS 68 OXT 
69 1 N 1 A GLU 69 ? OXT ? A GLU 69 OXT 
70 1 N 1 A ILE 70 ? OXT ? A ILE 70 OXT 
71 1 N 1 A LYS 71 ? OXT ? A LYS 71 OXT 
72 1 N 1 A GLU 72 ? OXT ? A GLU 72 OXT 
73 1 N 1 A TRP 73 ? OXT ? A TRP 73 OXT 
74 1 N 1 A ARG 74 ? OXT ? A ARG 74 OXT 
75 1 N 1 A ALA 75 ? OXT ? A ALA 75 OXT 
76 1 N 1 A ALA 76 ? OXT ? A ALA 76 OXT 
77 1 N 1 A ASN 77 ? OXT ? A ASN 77 OXT 
78 1 N 1 A GLY 78 ? OXT ? A GLY 78 OXT 
79 1 N 1 A LYS 79 ? OXT ? A LYS 79 OXT 
80 1 N 1 A SER 80 ? OXT ? A SER 80 OXT 
81 1 N 1 A GLY 81 ? OXT ? A GLY 81 OXT 
82 1 N 1 A PHE 82 ? OXT ? A PHE 82 OXT 
83 1 N 1 A LYS 83 ? OXT ? A LYS 83 OXT 
84 1 N 1 A GLN 84 ? OXT ? A GLN 84 OXT 
# 
_pdbx_entity_nonpoly.entity_id   1 
_pdbx_entity_nonpoly.name        'COLICIN E8 IMMUNITY PROTEIN' 
_pdbx_entity_nonpoly.comp_id     MET 
#