data_1ITY # _entry.id 1ITY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ITY RCSB RCSB005271 WWPDB D_1000005271 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1ba5 '1ba5 contains the same protein truncated in N- and C-termini.' unspecified TargetDB my_001000018.1 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ITY _pdbx_database_status.recvd_initial_deposition_date 2002-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nishikawa, T.' 1 'Okamura, H.' 2 'Nagadoi, A.' 3 'Konig, P.' 4 'Rhodes, D.' 5 'Nishimura, Y.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of a telomeric DNA complex of human TRF1' _citation.journal_abbrev Structure _citation.journal_volume 9 _citation.page_first 1237 _citation.page_last 1251 _citation.year 2001 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11738049 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(01)00688-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Nishikawa, T.' 1 primary 'Okamura, H.' 2 primary 'Nagadoi, A.' 3 primary 'Konig, P.' 4 primary 'Rhodes, D.' 5 primary 'Nishimura, Y.' 6 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description TRF1 _entity.formula_weight 8467.753 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DNA binding domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Telomeric repeat binding factor 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED _entity_poly.pdbx_seq_one_letter_code_can TPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier my_001000018.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 PRO n 1 3 GLU n 1 4 LYS n 1 5 HIS n 1 6 ARG n 1 7 ALA n 1 8 ARG n 1 9 LYS n 1 10 ARG n 1 11 GLN n 1 12 ALA n 1 13 TRP n 1 14 LEU n 1 15 TRP n 1 16 GLU n 1 17 GLU n 1 18 ASP n 1 19 LYS n 1 20 ASN n 1 21 LEU n 1 22 ARG n 1 23 SER n 1 24 GLY n 1 25 VAL n 1 26 ARG n 1 27 LYS n 1 28 TYR n 1 29 GLY n 1 30 GLU n 1 31 GLY n 1 32 ASN n 1 33 TRP n 1 34 SER n 1 35 LYS n 1 36 ILE n 1 37 LEU n 1 38 LEU n 1 39 HIS n 1 40 TYR n 1 41 LYS n 1 42 PHE n 1 43 ASN n 1 44 ASN n 1 45 ARG n 1 46 THR n 1 47 SER n 1 48 VAL n 1 49 MET n 1 50 LEU n 1 51 LYS n 1 52 ASP n 1 53 ARG n 1 54 TRP n 1 55 ARG n 1 56 THR n 1 57 MET n 1 58 LYS n 1 59 LYS n 1 60 LEU n 1 61 LYS n 1 62 LEU n 1 63 ILE n 1 64 SER n 1 65 SER n 1 66 ASP n 1 67 SER n 1 68 GLU n 1 69 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TRF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET13A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TERF1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED _struct_ref.pdbx_align_begin 371 _struct_ref.pdbx_db_accession P54274 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ITY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54274 _struct_ref_seq.db_align_beg 371 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 439 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 371 _struct_ref_seq.pdbx_auth_seq_align_end 439 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type ;3D HNHA, 3D HNHB, 3D Sequential assignment protocol, 3D_15N_separated_NOESY, 3D_13C_separated_NOESY, 2D NOESY, 2D TOCSY, 2D DQF-COSY ; # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5-2.5mM TRF1 U-15N, 13C, 50mM phosphate buffer, 100mM NaCl' _pdbx_nmr_sample_details.solvent_system '90% H2O, 10% D2O, 100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Bruker DRX 500 3 ? Bruker AMX 500 # _pdbx_nmr_refine.entry_id 1ITY _pdbx_nmr_refine.method 'distance geometry/simulated annealing' _pdbx_nmr_refine.details ;The structures are generated by 4D simulated annealing with EMBOSS, based on a total of 916 experimental restraints, 852 are NOE-derived distance restraints, 36 hydrogen restraints and 28 dihedral restraints. 25 out of 100 structures which have the lowest violation and a low energies were selected for the final set. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1ITY _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1ITY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ITY _pdbx_nmr_representative.conformer_id 2 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_software.name EMBOSS _pdbx_nmr_software.version 5.0 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors 'Nakai, T., Kidera, A., and Nakamura, H.' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1ITY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1ITY _struct.title 'Solution structure of the DNA binding domain of human TRF1' _struct.pdbx_descriptor 'Telomeric repeat binding factor 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ITY _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;helix-turn-helix, telomeres, DNA binding, Myb domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 14 ? GLY A 29 ? LEU A 384 GLY A 399 1 ? 16 HELX_P HELX_P2 2 ASN A 32 ? TYR A 40 ? ASN A 402 TYR A 410 1 ? 9 HELX_P HELX_P3 3 THR A 46 ? LEU A 60 ? THR A 416 LEU A 430 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1ITY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ITY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 371 ? ? ? A . n A 1 2 PRO 2 372 ? ? ? A . n A 1 3 GLU 3 373 373 GLU GLU A . n A 1 4 LYS 4 374 374 LYS LYS A . n A 1 5 HIS 5 375 375 HIS HIS A . n A 1 6 ARG 6 376 376 ARG ARG A . n A 1 7 ALA 7 377 377 ALA ALA A . n A 1 8 ARG 8 378 378 ARG ARG A . n A 1 9 LYS 9 379 379 LYS LYS A . n A 1 10 ARG 10 380 380 ARG ARG A . n A 1 11 GLN 11 381 381 GLN GLN A . n A 1 12 ALA 12 382 382 ALA ALA A . n A 1 13 TRP 13 383 383 TRP TRP A . n A 1 14 LEU 14 384 384 LEU LEU A . n A 1 15 TRP 15 385 385 TRP TRP A . n A 1 16 GLU 16 386 386 GLU GLU A . n A 1 17 GLU 17 387 387 GLU GLU A . n A 1 18 ASP 18 388 388 ASP ASP A . n A 1 19 LYS 19 389 389 LYS LYS A . n A 1 20 ASN 20 390 390 ASN ASN A . n A 1 21 LEU 21 391 391 LEU LEU A . n A 1 22 ARG 22 392 392 ARG ARG A . n A 1 23 SER 23 393 393 SER SER A . n A 1 24 GLY 24 394 394 GLY GLY A . n A 1 25 VAL 25 395 395 VAL VAL A . n A 1 26 ARG 26 396 396 ARG ARG A . n A 1 27 LYS 27 397 397 LYS LYS A . n A 1 28 TYR 28 398 398 TYR TYR A . n A 1 29 GLY 29 399 399 GLY GLY A . n A 1 30 GLU 30 400 400 GLU GLU A . n A 1 31 GLY 31 401 401 GLY GLY A . n A 1 32 ASN 32 402 402 ASN ASN A . n A 1 33 TRP 33 403 403 TRP TRP A . n A 1 34 SER 34 404 404 SER SER A . n A 1 35 LYS 35 405 405 LYS LYS A . n A 1 36 ILE 36 406 406 ILE ILE A . n A 1 37 LEU 37 407 407 LEU LEU A . n A 1 38 LEU 38 408 408 LEU LEU A . n A 1 39 HIS 39 409 409 HIS HIS A . n A 1 40 TYR 40 410 410 TYR TYR A . n A 1 41 LYS 41 411 411 LYS LYS A . n A 1 42 PHE 42 412 412 PHE PHE A . n A 1 43 ASN 43 413 413 ASN ASN A . n A 1 44 ASN 44 414 414 ASN ASN A . n A 1 45 ARG 45 415 415 ARG ARG A . n A 1 46 THR 46 416 416 THR THR A . n A 1 47 SER 47 417 417 SER SER A . n A 1 48 VAL 48 418 418 VAL VAL A . n A 1 49 MET 49 419 419 MET MET A . n A 1 50 LEU 50 420 420 LEU LEU A . n A 1 51 LYS 51 421 421 LYS LYS A . n A 1 52 ASP 52 422 422 ASP ASP A . n A 1 53 ARG 53 423 423 ARG ARG A . n A 1 54 TRP 54 424 424 TRP TRP A . n A 1 55 ARG 55 425 425 ARG ARG A . n A 1 56 THR 56 426 426 THR THR A . n A 1 57 MET 57 427 427 MET MET A . n A 1 58 LYS 58 428 428 LYS LYS A . n A 1 59 LYS 59 429 429 LYS LYS A . n A 1 60 LEU 60 430 430 LEU LEU A . n A 1 61 LYS 61 431 431 LYS LYS A . n A 1 62 LEU 62 432 432 LEU LEU A . n A 1 63 ILE 63 433 433 ILE ILE A . n A 1 64 SER 64 434 434 SER SER A . n A 1 65 SER 65 435 435 SER SER A . n A 1 66 ASP 66 436 436 ASP ASP A . n A 1 67 SER 67 437 437 SER SER A . n A 1 68 GLU 68 438 438 GLU GLU A . n A 1 69 ASP 69 439 439 ASP ASP A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-03-06 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 14 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 415 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 415 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 415 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.14 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.16 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 374 ? ? -69.80 71.33 2 1 HIS A 375 ? ? 172.92 -35.50 3 1 LYS A 379 ? ? 74.15 118.64 4 1 ASN A 402 ? ? -149.06 53.91 5 1 ASN A 414 ? ? -154.73 73.76 6 1 LYS A 431 ? ? -88.94 43.96 7 1 LEU A 432 ? ? -11.48 93.44 8 1 SER A 434 ? ? 56.50 -135.51 9 1 ASP A 436 ? ? -146.33 24.80 10 2 ARG A 378 ? ? 49.38 -100.16 11 2 LYS A 379 ? ? -141.28 36.39 12 2 GLN A 381 ? ? -69.74 68.97 13 2 ALA A 382 ? ? -162.26 52.75 14 2 TRP A 383 ? ? 64.55 171.12 15 2 ASN A 414 ? ? 62.19 88.83 16 2 LYS A 429 ? ? -75.90 -72.25 17 2 LYS A 431 ? ? 179.55 -21.59 18 2 SER A 434 ? ? -153.77 69.04 19 3 LYS A 374 ? ? 55.87 -116.06 20 3 HIS A 375 ? ? -157.35 46.27 21 3 ARG A 376 ? ? 71.55 173.25 22 3 ARG A 378 ? ? -179.39 -167.61 23 3 LYS A 379 ? ? -31.96 129.63 24 3 ARG A 380 ? ? -170.71 -168.57 25 3 TRP A 383 ? ? 56.87 79.19 26 3 ASN A 402 ? ? -76.21 47.61 27 3 LEU A 432 ? ? 67.09 62.09 28 3 SER A 434 ? ? -165.61 -86.45 29 3 SER A 435 ? ? -122.72 -109.54 30 3 ASP A 436 ? ? -150.02 -73.27 31 4 LYS A 374 ? ? 178.37 -70.25 32 4 HIS A 375 ? ? 59.94 -175.09 33 4 ARG A 376 ? ? 66.27 115.29 34 4 ARG A 380 ? ? -57.53 98.54 35 4 ALA A 382 ? ? 55.19 -131.83 36 4 ASN A 414 ? ? 61.31 83.50 37 4 LEU A 430 ? ? -178.15 -42.30 38 4 LYS A 431 ? ? -19.11 -58.43 39 4 LEU A 432 ? ? -162.72 32.30 40 5 ALA A 377 ? ? -162.56 57.08 41 5 ARG A 380 ? ? -77.67 34.71 42 5 ALA A 382 ? ? 176.66 73.61 43 5 LEU A 430 ? ? 178.94 37.22 44 5 LEU A 432 ? ? -129.34 -56.14 45 5 ILE A 433 ? ? -79.54 -87.06 46 6 ARG A 378 ? ? 60.57 68.59 47 6 TRP A 383 ? ? 52.38 73.05 48 6 ASN A 414 ? ? -161.02 64.08 49 6 LYS A 431 ? ? -159.55 -67.89 50 6 LEU A 432 ? ? -169.73 -83.00 51 6 SER A 434 ? ? -158.56 -159.49 52 6 SER A 435 ? ? 72.13 -44.86 53 7 HIS A 375 ? ? 58.08 74.53 54 7 ARG A 378 ? ? 72.37 -59.22 55 7 LYS A 379 ? ? 74.30 120.65 56 7 ALA A 382 ? ? 51.40 -148.12 57 7 ASN A 414 ? ? 54.35 78.02 58 7 SER A 434 ? ? -178.64 69.74 59 7 GLU A 438 ? ? 111.12 -75.34 60 8 GLN A 381 ? ? 70.15 -39.32 61 8 SER A 435 ? ? -154.20 36.87 62 9 HIS A 375 ? ? -156.90 -79.34 63 9 ARG A 376 ? ? -164.91 91.06 64 9 ARG A 380 ? ? -85.72 -70.55 65 9 LYS A 431 ? ? -85.21 -89.92 66 9 LEU A 432 ? ? 175.53 31.41 67 9 SER A 434 ? ? -178.86 45.32 68 9 SER A 435 ? ? 70.21 -74.68 69 9 ASP A 436 ? ? 21.78 67.64 70 10 ARG A 376 ? ? 65.51 -71.66 71 10 ALA A 377 ? ? 60.48 -157.64 72 10 TRP A 383 ? ? 71.26 112.79 73 10 LEU A 432 ? ? 65.50 66.08 74 10 SER A 437 ? ? -161.52 -145.37 75 11 HIS A 375 ? ? 79.88 118.63 76 11 ARG A 376 ? ? 73.55 -38.29 77 11 TRP A 383 ? ? 70.61 99.57 78 11 ASN A 402 ? ? -75.87 46.08 79 11 LYS A 429 ? ? -27.15 -66.24 80 11 LYS A 431 ? ? 59.44 14.51 81 11 ILE A 433 ? ? -135.16 -46.76 82 11 SER A 435 ? ? 72.19 176.42 83 11 SER A 437 ? ? 68.26 172.76 84 11 GLU A 438 ? ? -162.00 114.33 85 12 ARG A 376 ? ? 74.47 108.11 86 12 ARG A 378 ? ? 74.34 -63.87 87 12 LYS A 379 ? ? 176.65 -167.20 88 12 GLN A 381 ? ? 79.54 117.72 89 12 ALA A 382 ? ? -162.80 48.48 90 12 TRP A 383 ? ? 59.70 170.49 91 12 ASN A 402 ? ? -76.43 46.17 92 12 ASN A 414 ? ? 65.96 93.72 93 13 LYS A 379 ? ? 56.89 -127.51 94 13 ALA A 382 ? ? 61.17 -138.46 95 13 ASN A 402 ? ? -76.71 41.84 96 13 LEU A 432 ? ? -87.85 41.26 97 13 SER A 435 ? ? -19.19 107.38 98 13 ASP A 436 ? ? -27.88 -60.68 99 13 SER A 437 ? ? -79.33 -77.05 100 14 ARG A 376 ? ? 72.10 178.43 101 14 ARG A 380 ? ? -101.77 -168.11 102 14 ASN A 413 ? ? -75.74 47.35 103 14 ASN A 414 ? ? 77.65 87.41 104 14 LEU A 432 ? ? 60.46 65.35 105 14 SER A 434 ? ? 66.49 63.76 106 14 GLU A 438 ? ? 69.83 165.79 107 15 LYS A 374 ? ? 79.44 56.47 108 15 HIS A 375 ? ? 75.81 -69.43 109 15 ARG A 376 ? ? 65.85 176.09 110 15 LYS A 379 ? ? 77.31 142.33 111 15 ALA A 382 ? ? -77.96 -158.71 112 15 ASN A 402 ? ? -78.25 49.46 113 15 ASN A 414 ? ? -164.93 42.83 114 15 LYS A 429 ? ? -75.75 25.78 115 15 LEU A 432 ? ? -145.41 -50.04 116 16 LYS A 374 ? ? 68.57 151.47 117 16 ARG A 376 ? ? -156.38 48.54 118 16 ARG A 378 ? ? -158.05 75.21 119 16 ASN A 402 ? ? -149.49 45.93 120 16 ASN A 414 ? ? -158.33 72.14 121 16 LEU A 430 ? ? -179.78 51.56 122 16 LYS A 431 ? ? -116.31 -91.93 123 16 SER A 435 ? ? 87.94 -144.82 124 16 SER A 437 ? ? 121.78 131.17 125 17 HIS A 375 ? ? -78.17 -92.76 126 17 ARG A 376 ? ? -152.06 -67.88 127 17 ALA A 377 ? ? -148.67 -13.40 128 17 ARG A 380 ? ? -120.63 -61.84 129 17 GLN A 381 ? ? -141.51 -80.82 130 17 ALA A 382 ? ? -123.59 -153.87 131 17 TRP A 383 ? ? 73.51 69.34 132 17 LEU A 430 ? ? -170.58 33.63 133 17 LEU A 432 ? ? -167.12 -54.24 134 17 ILE A 433 ? ? -69.95 95.79 135 17 SER A 435 ? ? 65.81 -94.90 136 17 SER A 437 ? ? 30.69 -110.15 137 17 GLU A 438 ? ? 164.64 -42.76 138 18 LYS A 374 ? ? -136.02 -68.45 139 18 ARG A 380 ? ? 72.00 126.64 140 18 GLN A 381 ? ? 73.07 -48.43 141 18 ASN A 402 ? ? -74.42 43.45 142 18 TYR A 410 ? ? -97.83 -154.19 143 18 LYS A 431 ? ? 84.71 37.67 144 18 ASP A 436 ? ? 53.42 -146.77 145 18 SER A 437 ? ? -86.10 -75.38 146 19 HIS A 375 ? ? -118.08 65.72 147 19 ARG A 376 ? ? -150.94 48.25 148 19 LYS A 379 ? ? -73.75 35.00 149 19 GLN A 381 ? ? -81.21 44.44 150 19 ALA A 382 ? ? 54.80 -172.55 151 19 ASN A 402 ? ? -75.56 46.74 152 19 ASN A 414 ? ? 66.14 85.10 153 19 LEU A 430 ? ? -165.45 40.45 154 19 LYS A 431 ? ? -91.22 -71.81 155 19 LEU A 432 ? ? -173.79 41.10 156 19 SER A 437 ? ? -150.60 34.26 157 20 LYS A 374 ? ? 64.26 -166.12 158 20 ARG A 380 ? ? -163.38 -48.65 159 20 GLN A 381 ? ? -55.55 -4.05 160 20 ALA A 382 ? ? -71.74 -162.60 161 20 ASN A 414 ? ? -168.15 83.54 162 20 LEU A 432 ? ? 75.91 84.40 163 20 ILE A 433 ? ? -29.42 109.82 164 20 SER A 434 ? ? -175.15 119.43 165 21 LYS A 374 ? ? 76.08 -63.39 166 21 GLN A 381 ? ? -148.31 29.27 167 21 ASN A 414 ? ? 62.61 68.98 168 21 ASP A 436 ? ? -91.14 -72.10 169 21 SER A 437 ? ? -153.71 41.51 170 22 HIS A 375 ? ? -85.71 -78.39 171 22 ARG A 376 ? ? -171.55 -61.21 172 22 LYS A 379 ? ? -125.49 -66.52 173 22 TRP A 383 ? ? 52.20 89.16 174 22 ASN A 402 ? ? -76.75 48.77 175 22 ASN A 413 ? ? -91.39 -61.12 176 22 ASN A 414 ? ? -156.55 39.56 177 22 LEU A 432 ? ? 63.57 88.38 178 22 ILE A 433 ? ? -45.83 93.72 179 22 GLU A 438 ? ? -161.94 -65.74 180 23 LYS A 374 ? ? 66.80 -73.00 181 23 ARG A 378 ? ? 54.93 81.79 182 23 LYS A 379 ? ? -83.95 -77.05 183 23 ARG A 380 ? ? 70.49 161.34 184 23 ASN A 402 ? ? -76.67 45.04 185 23 LEU A 430 ? ? -61.04 -77.49 186 23 LYS A 431 ? ? -173.42 -48.88 187 23 LEU A 432 ? ? -28.91 -62.52 188 24 ARG A 376 ? ? 61.42 63.91 189 24 ARG A 380 ? ? 55.31 96.10 190 24 ASN A 413 ? ? -69.92 -74.74 191 24 LYS A 429 ? ? -84.21 41.19 192 24 LEU A 430 ? ? -147.05 -43.69 193 24 LYS A 431 ? ? 123.78 -13.24 194 24 LEU A 432 ? ? -80.31 46.96 195 24 SER A 437 ? ? -151.78 75.08 196 25 LYS A 374 ? ? -170.98 132.14 197 25 HIS A 375 ? ? -165.16 -67.17 198 25 LYS A 379 ? ? -164.19 -43.96 199 25 ARG A 380 ? ? -143.59 -53.57 200 25 TRP A 383 ? ? 70.16 85.77 201 25 ASN A 402 ? ? -76.29 49.07 202 25 LYS A 431 ? ? 101.52 -21.74 203 25 SER A 434 ? ? -154.47 -56.68 204 25 SER A 435 ? ? 104.25 162.42 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 12 ARG A 376 ? ? 0.165 'SIDE CHAIN' 2 15 ARG A 415 ? ? 0.118 'SIDE CHAIN' 3 18 ARG A 378 ? ? 0.091 'SIDE CHAIN' 4 22 ARG A 423 ? ? 0.111 'SIDE CHAIN' 5 24 ARG A 423 ? ? 0.093 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 371 ? A THR 1 2 1 Y 1 A PRO 372 ? A PRO 2 3 2 Y 1 A THR 371 ? A THR 1 4 2 Y 1 A PRO 372 ? A PRO 2 5 3 Y 1 A THR 371 ? A THR 1 6 3 Y 1 A PRO 372 ? A PRO 2 7 4 Y 1 A THR 371 ? A THR 1 8 4 Y 1 A PRO 372 ? A PRO 2 9 5 Y 1 A THR 371 ? A THR 1 10 5 Y 1 A PRO 372 ? A PRO 2 11 6 Y 1 A THR 371 ? A THR 1 12 6 Y 1 A PRO 372 ? A PRO 2 13 7 Y 1 A THR 371 ? A THR 1 14 7 Y 1 A PRO 372 ? A PRO 2 15 8 Y 1 A THR 371 ? A THR 1 16 8 Y 1 A PRO 372 ? A PRO 2 17 9 Y 1 A THR 371 ? A THR 1 18 9 Y 1 A PRO 372 ? A PRO 2 19 10 Y 1 A THR 371 ? A THR 1 20 10 Y 1 A PRO 372 ? A PRO 2 21 11 Y 1 A THR 371 ? A THR 1 22 11 Y 1 A PRO 372 ? A PRO 2 23 12 Y 1 A THR 371 ? A THR 1 24 12 Y 1 A PRO 372 ? A PRO 2 25 13 Y 1 A THR 371 ? A THR 1 26 13 Y 1 A PRO 372 ? A PRO 2 27 14 Y 1 A THR 371 ? A THR 1 28 14 Y 1 A PRO 372 ? A PRO 2 29 15 Y 1 A THR 371 ? A THR 1 30 15 Y 1 A PRO 372 ? A PRO 2 31 16 Y 1 A THR 371 ? A THR 1 32 16 Y 1 A PRO 372 ? A PRO 2 33 17 Y 1 A THR 371 ? A THR 1 34 17 Y 1 A PRO 372 ? A PRO 2 35 18 Y 1 A THR 371 ? A THR 1 36 18 Y 1 A PRO 372 ? A PRO 2 37 19 Y 1 A THR 371 ? A THR 1 38 19 Y 1 A PRO 372 ? A PRO 2 39 20 Y 1 A THR 371 ? A THR 1 40 20 Y 1 A PRO 372 ? A PRO 2 41 21 Y 1 A THR 371 ? A THR 1 42 21 Y 1 A PRO 372 ? A PRO 2 43 22 Y 1 A THR 371 ? A THR 1 44 22 Y 1 A PRO 372 ? A PRO 2 45 23 Y 1 A THR 371 ? A THR 1 46 23 Y 1 A PRO 372 ? A PRO 2 47 24 Y 1 A THR 371 ? A THR 1 48 24 Y 1 A PRO 372 ? A PRO 2 49 25 Y 1 A THR 371 ? A THR 1 50 25 Y 1 A PRO 372 ? A PRO 2 #