data_1IUZ # _entry.id 1IUZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1IUZ WWPDB D_1000174272 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IUZ _pdbx_database_status.recvd_initial_deposition_date 1996-10-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Shibata, N.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Novel insight into the copper-ligand geometry in the crystal structure of Ulva pertusa plastocyanin at 1.6-A resolution. Structural basis for regulation of the copper site by residue 88. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 274 _citation.page_first 4225 _citation.page_last 4230 _citation.year 1999 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9933621 _citation.pdbx_database_id_DOI 10.1074/jbc.274.7.4225 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Shibata, N.' 1 primary 'Inoue, T.' 2 primary 'Nagano, C.' 3 primary 'Nishio, N.' 4 primary 'Kohzuma, T.' 5 primary 'Onodera, K.' 6 primary 'Yoshizaki, F.' 7 primary 'Sugimura, Y.' 8 primary 'Kai, Y.' 9 # _cell.entry_id 1IUZ _cell.length_a 88.300 _cell.length_b 88.300 _cell.length_c 88.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IUZ _symmetry.space_group_name_H-M 'P 43 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 212 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat PLASTOCYANIN 10197.375 1 ? ? ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 105 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYG VYCEPHAGAGMKMTITVQ ; _entity_poly.pdbx_seq_one_letter_code_can ;AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYG VYCEPHAGAGMKMTITVQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 ILE n 1 4 VAL n 1 5 LYS n 1 6 LEU n 1 7 GLY n 1 8 GLY n 1 9 ASP n 1 10 ASP n 1 11 GLY n 1 12 SER n 1 13 LEU n 1 14 ALA n 1 15 PHE n 1 16 VAL n 1 17 PRO n 1 18 SER n 1 19 LYS n 1 20 ILE n 1 21 SER n 1 22 VAL n 1 23 ALA n 1 24 ALA n 1 25 GLY n 1 26 GLU n 1 27 ALA n 1 28 ILE n 1 29 GLU n 1 30 PHE n 1 31 VAL n 1 32 ASN n 1 33 ASN n 1 34 ALA n 1 35 GLY n 1 36 PHE n 1 37 PRO n 1 38 HIS n 1 39 ASN n 1 40 ILE n 1 41 VAL n 1 42 PHE n 1 43 ASP n 1 44 GLU n 1 45 ASP n 1 46 ALA n 1 47 VAL n 1 48 PRO n 1 49 ALA n 1 50 GLY n 1 51 VAL n 1 52 ASP n 1 53 ALA n 1 54 ASP n 1 55 ALA n 1 56 ILE n 1 57 SER n 1 58 TYR n 1 59 ASP n 1 60 ASP n 1 61 TYR n 1 62 LEU n 1 63 ASN n 1 64 SER n 1 65 LYS n 1 66 GLY n 1 67 GLU n 1 68 THR n 1 69 VAL n 1 70 VAL n 1 71 ARG n 1 72 LYS n 1 73 LEU n 1 74 SER n 1 75 THR n 1 76 PRO n 1 77 GLY n 1 78 VAL n 1 79 TYR n 1 80 GLY n 1 81 VAL n 1 82 TYR n 1 83 CYS n 1 84 GLU n 1 85 PRO n 1 86 HIS n 1 87 ALA n 1 88 GLY n 1 89 ALA n 1 90 GLY n 1 91 MET n 1 92 LYS n 1 93 MET n 1 94 THR n 1 95 ILE n 1 96 THR n 1 97 VAL n 1 98 GLN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Ulva pertusa' _entity_src_nat.pdbx_ncbi_taxonomy_id 3120 _entity_src_nat.genus Ulva _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PLAS_ULVPE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56274 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYG VYCEPHAGAGMKMTITVQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IUZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56274 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 99 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1IUZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.81 _exptl_crystal.density_percent_sol 55. _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector DIFFRACTOMETER _diffrn_detector.type WEISSENBERG _diffrn_detector.pdbx_collection_date 1996-06-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-6A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline BL-6A _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1IUZ _reflns.observed_criterion_sigma_I 1. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 14759 _reflns.number_all ? _reflns.percent_possible_obs 0.92 _reflns.pdbx_Rmerge_I_obs 0.0820000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.86 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1IUZ _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 1.6 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1760000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1760000 _refine.ls_R_factor_R_free 0.2110000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5. _refine.ls_number_reflns_R_free 684 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 20.9 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1IUZ _refine_analyze.Luzzati_coordinate_error_obs 0.2 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 717 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 110 _refine_hist.number_atoms_total 828 _refine_hist.d_res_high 1.6 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.012 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 5.6 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 29.0 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.1 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1IUZ _struct.title PLASTOCYANIN _struct.pdbx_descriptor PLASTOCYANIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IUZ _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 52 ? SER A 57 ? ASP A 51 SER A 56 1 ? 6 HELX_P HELX_P2 2 HIS A 86 ? GLY A 90 ? HIS A 87 GLY A 91 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CU . CU ? ? ? 1_555 A HIS 38 ND1 ? ? A CU 100 A HIS 37 1_555 ? ? ? ? ? ? ? 2.084 ? metalc2 metalc ? ? B CU . CU ? ? ? 1_555 A CYS 83 SG ? ? A CU 100 A CYS 84 1_555 ? ? ? ? ? ? ? 2.180 ? metalc3 metalc ? ? B CU . CU ? ? ? 1_555 A HIS 86 ND1 ? ? A CU 100 A HIS 87 1_555 ? ? ? ? ? ? ? 2.064 ? metalc4 metalc ? ? B CU . CU ? ? ? 1_555 A MET 91 SD ? ? A CU 100 A MET 92 1_555 ? ? ? ? ? ? ? 2.689 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 16 A . ? VAL 15 A PRO 17 A ? PRO 16 A 1 -5.65 2 PHE 36 A . ? PHE 35 A PRO 37 A ? PRO 36 A 1 3.23 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 15 ? VAL A 16 ? PHE A 14 VAL A 15 A 2 GLN A 2 ? LEU A 6 ? GLN A 1 LEU A 5 A 3 ALA A 27 ? ASN A 32 ? ALA A 26 ASN A 31 A 4 THR A 68 ? LYS A 72 ? THR A 69 LYS A 73 B 1 LYS A 19 ? ALA A 23 ? LYS A 18 ALA A 22 B 2 LYS A 92 ? GLN A 98 ? LYS A 93 GLN A 99 B 3 GLY A 77 ? TYR A 82 ? GLY A 78 TYR A 83 B 4 ILE A 40 ? GLU A 44 ? ILE A 39 GLU A 43 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 16 ? O VAL A 15 N LYS A 5 ? N LYS A 4 A 2 3 O GLN A 2 ? O GLN A 1 N GLU A 29 ? N GLU A 28 A 3 4 O ILE A 28 ? O ILE A 27 N ARG A 71 ? N ARG A 72 B 1 2 O ILE A 20 ? O ILE A 19 N THR A 94 ? N THR A 95 B 2 3 O MET A 93 ? O MET A 94 N VAL A 81 ? N VAL A 82 B 3 4 O TYR A 82 ? O TYR A 83 N VAL A 41 ? N VAL A 40 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details COP Unknown ? ? ? ? 5 'COPPER BINDING SITE.' AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU A 100' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 COP 5 CU B . ? CU A 100 . ? 1_555 ? 2 COP 5 HIS A 38 ? HIS A 37 . ? 1_555 ? 3 COP 5 CYS A 83 ? CYS A 84 . ? 1_555 ? 4 COP 5 HIS A 86 ? HIS A 87 . ? 1_555 ? 5 COP 5 MET A 91 ? MET A 92 . ? 1_555 ? 6 AC1 4 HIS A 38 ? HIS A 37 . ? 1_555 ? 7 AC1 4 CYS A 83 ? CYS A 84 . ? 1_555 ? 8 AC1 4 HIS A 86 ? HIS A 87 . ? 1_555 ? 9 AC1 4 MET A 91 ? MET A 92 . ? 1_555 ? 10 AC2 3 ALA A 1 ? ALA A 0 . ? 1_555 ? 11 AC2 3 GLU A 26 ? GLU A 25 . ? 1_555 ? 12 AC2 3 ALA A 27 ? ALA A 26 . ? 1_555 ? # _database_PDB_matrix.entry_id 1IUZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IUZ _atom_sites.fract_transf_matrix[1][1] 0.011325 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011325 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011325 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 0 0 ALA ALA A . n A 1 2 GLN 2 1 1 GLN GLN A . n A 1 3 ILE 3 2 2 ILE ILE A . n A 1 4 VAL 4 3 3 VAL VAL A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 GLY 7 6 6 GLY GLY A . n A 1 8 GLY 8 7 7 GLY GLY A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 ASP 10 9 9 ASP ASP A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 SER 12 11 11 SER SER A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 PHE 15 14 14 PHE PHE A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 PRO 17 16 16 PRO PRO A . n A 1 18 SER 18 17 17 SER SER A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 ILE 20 19 19 ILE ILE A . n A 1 21 SER 21 20 20 SER SER A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 ILE 28 27 27 ILE ILE A . n A 1 29 GLU 29 28 28 GLU GLU A . n A 1 30 PHE 30 29 29 PHE PHE A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 ASN 32 31 31 ASN ASN A . n A 1 33 ASN 33 32 32 ASN ASN A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 GLY 35 34 34 GLY GLY A . n A 1 36 PHE 36 35 35 PHE PHE A . n A 1 37 PRO 37 36 36 PRO PRO A . n A 1 38 HIS 38 37 37 HIS HIS A . n A 1 39 ASN 39 38 38 ASN ASN A . n A 1 40 ILE 40 39 39 ILE ILE A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 PHE 42 41 41 PHE PHE A . n A 1 43 ASP 43 42 42 ASP ASP A . n A 1 44 GLU 44 43 43 GLU GLU A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ALA 46 45 45 ALA ALA A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 PRO 48 47 47 PRO PRO A . n A 1 49 ALA 49 48 48 ALA ALA A . n A 1 50 GLY 50 49 49 GLY GLY A . n A 1 51 VAL 51 50 50 VAL VAL A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 ALA 53 52 52 ALA ALA A . n A 1 54 ASP 54 53 53 ASP ASP A . n A 1 55 ALA 55 54 54 ALA ALA A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 SER 57 56 56 SER SER A . n A 1 58 TYR 58 57 57 TYR TYR A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASP 60 61 61 ASP ASP A . n A 1 61 TYR 61 62 62 TYR TYR A . n A 1 62 LEU 62 63 63 LEU LEU A . n A 1 63 ASN 63 64 64 ASN ASN A . n A 1 64 SER 64 65 65 SER SER A . n A 1 65 LYS 65 66 66 LYS LYS A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 GLU 67 68 68 GLU GLU A . n A 1 68 THR 68 69 69 THR THR A . n A 1 69 VAL 69 70 70 VAL VAL A . n A 1 70 VAL 70 71 71 VAL VAL A . n A 1 71 ARG 71 72 72 ARG ARG A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 LEU 73 74 74 LEU LEU A . n A 1 74 SER 74 75 75 SER SER A . n A 1 75 THR 75 76 76 THR THR A . n A 1 76 PRO 76 77 77 PRO PRO A . n A 1 77 GLY 77 78 78 GLY GLY A . n A 1 78 VAL 78 79 79 VAL VAL A . n A 1 79 TYR 79 80 80 TYR TYR A . n A 1 80 GLY 80 81 81 GLY GLY A . n A 1 81 VAL 81 82 82 VAL VAL A . n A 1 82 TYR 82 83 83 TYR TYR A . n A 1 83 CYS 83 84 84 CYS CYS A . n A 1 84 GLU 84 85 85 GLU GLU A . n A 1 85 PRO 85 86 86 PRO PRO A . n A 1 86 HIS 86 87 87 HIS HIS A . n A 1 87 ALA 87 88 88 ALA ALA A . n A 1 88 GLY 88 89 89 GLY GLY A . n A 1 89 ALA 89 90 90 ALA ALA A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 MET 91 92 92 MET MET A . n A 1 92 LYS 92 93 93 LYS LYS A . n A 1 93 MET 93 94 94 MET MET A . n A 1 94 THR 94 95 95 THR THR A . n A 1 95 ILE 95 96 96 ILE ILE A . n A 1 96 THR 96 97 97 THR THR A . n A 1 97 VAL 97 98 98 VAL VAL A . n A 1 98 GLN 98 99 99 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 100 100 CU CU A . C 3 SO4 1 200 200 SO4 SO4 A . D 4 HOH 1 201 201 HOH HOH A . D 4 HOH 2 202 202 HOH HOH A . D 4 HOH 3 203 203 HOH HOH A . D 4 HOH 4 204 204 HOH HOH A . D 4 HOH 5 205 205 HOH HOH A . D 4 HOH 6 206 206 HOH HOH A . D 4 HOH 7 207 207 HOH HOH A . D 4 HOH 8 208 208 HOH HOH A . D 4 HOH 9 209 209 HOH HOH A . D 4 HOH 10 210 210 HOH HOH A . D 4 HOH 11 211 211 HOH HOH A . D 4 HOH 12 212 212 HOH HOH A . D 4 HOH 13 213 213 HOH HOH A . D 4 HOH 14 214 214 HOH HOH A . D 4 HOH 15 215 215 HOH HOH A . D 4 HOH 16 216 216 HOH HOH A . D 4 HOH 17 217 217 HOH HOH A . D 4 HOH 18 218 218 HOH HOH A . D 4 HOH 19 219 219 HOH HOH A . D 4 HOH 20 220 220 HOH HOH A . D 4 HOH 21 221 221 HOH HOH A . D 4 HOH 22 222 222 HOH HOH A . D 4 HOH 23 223 223 HOH HOH A . D 4 HOH 24 224 224 HOH HOH A . D 4 HOH 25 225 225 HOH HOH A . D 4 HOH 26 226 226 HOH HOH A . D 4 HOH 27 227 227 HOH HOH A . D 4 HOH 28 228 228 HOH HOH A . D 4 HOH 29 229 229 HOH HOH A . D 4 HOH 30 230 230 HOH HOH A . D 4 HOH 31 231 231 HOH HOH A . D 4 HOH 32 232 232 HOH HOH A . D 4 HOH 33 233 233 HOH HOH A . D 4 HOH 34 234 234 HOH HOH A . D 4 HOH 35 235 235 HOH HOH A . D 4 HOH 36 236 236 HOH HOH A . D 4 HOH 37 237 237 HOH HOH A . D 4 HOH 38 238 238 HOH HOH A . D 4 HOH 39 239 239 HOH HOH A . D 4 HOH 40 240 240 HOH HOH A . D 4 HOH 41 241 241 HOH HOH A . D 4 HOH 42 242 242 HOH HOH A . D 4 HOH 43 243 243 HOH HOH A . D 4 HOH 44 244 244 HOH HOH A . D 4 HOH 45 245 245 HOH HOH A . D 4 HOH 46 246 246 HOH HOH A . D 4 HOH 47 247 247 HOH HOH A . D 4 HOH 48 248 248 HOH HOH A . D 4 HOH 49 249 249 HOH HOH A . D 4 HOH 50 250 250 HOH HOH A . D 4 HOH 51 251 251 HOH HOH A . D 4 HOH 52 252 252 HOH HOH A . D 4 HOH 53 253 253 HOH HOH A . D 4 HOH 54 254 254 HOH HOH A . D 4 HOH 55 255 255 HOH HOH A . D 4 HOH 56 256 256 HOH HOH A . D 4 HOH 57 257 257 HOH HOH A . D 4 HOH 58 258 258 HOH HOH A . D 4 HOH 59 259 259 HOH HOH A . D 4 HOH 60 260 260 HOH HOH A . D 4 HOH 61 261 261 HOH HOH A . D 4 HOH 62 262 262 HOH HOH A . D 4 HOH 63 263 263 HOH HOH A . D 4 HOH 64 264 264 HOH HOH A . D 4 HOH 65 265 265 HOH HOH A . D 4 HOH 66 266 266 HOH HOH A . D 4 HOH 67 267 267 HOH HOH A . D 4 HOH 68 268 268 HOH HOH A . D 4 HOH 69 269 269 HOH HOH A . D 4 HOH 70 270 270 HOH HOH A . D 4 HOH 71 271 271 HOH HOH A . D 4 HOH 72 272 272 HOH HOH A . D 4 HOH 73 273 273 HOH HOH A . D 4 HOH 74 274 274 HOH HOH A . D 4 HOH 75 275 275 HOH HOH A . D 4 HOH 76 276 276 HOH HOH A . D 4 HOH 77 277 277 HOH HOH A . D 4 HOH 78 278 278 HOH HOH A . D 4 HOH 79 279 279 HOH HOH A . D 4 HOH 80 280 280 HOH HOH A . D 4 HOH 81 281 281 HOH HOH A . D 4 HOH 82 282 282 HOH HOH A . D 4 HOH 83 283 283 HOH HOH A . D 4 HOH 84 284 284 HOH HOH A . D 4 HOH 85 285 285 HOH HOH A . D 4 HOH 86 286 286 HOH HOH A . D 4 HOH 87 287 287 HOH HOH A . D 4 HOH 88 288 288 HOH HOH A . D 4 HOH 89 289 289 HOH HOH A . D 4 HOH 90 290 290 HOH HOH A . D 4 HOH 91 291 291 HOH HOH A . D 4 HOH 92 292 292 HOH HOH A . D 4 HOH 93 293 293 HOH HOH A . D 4 HOH 94 294 294 HOH HOH A . D 4 HOH 95 295 295 HOH HOH A . D 4 HOH 96 296 296 HOH HOH A . D 4 HOH 97 297 297 HOH HOH A . D 4 HOH 98 298 298 HOH HOH A . D 4 HOH 99 299 299 HOH HOH A . D 4 HOH 100 300 300 HOH HOH A . D 4 HOH 101 301 301 HOH HOH A . D 4 HOH 102 302 302 HOH HOH A . D 4 HOH 103 303 303 HOH HOH A . D 4 HOH 104 304 304 HOH HOH A . D 4 HOH 105 305 305 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 227 ? D HOH . 2 1 A HOH 250 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 38 ? A HIS 37 ? 1_555 CU ? B CU . ? A CU 100 ? 1_555 SG ? A CYS 83 ? A CYS 84 ? 1_555 133.0 ? 2 ND1 ? A HIS 38 ? A HIS 37 ? 1_555 CU ? B CU . ? A CU 100 ? 1_555 ND1 ? A HIS 86 ? A HIS 87 ? 1_555 96.2 ? 3 SG ? A CYS 83 ? A CYS 84 ? 1_555 CU ? B CU . ? A CU 100 ? 1_555 ND1 ? A HIS 86 ? A HIS 87 ? 1_555 115.3 ? 4 ND1 ? A HIS 38 ? A HIS 37 ? 1_555 CU ? B CU . ? A CU 100 ? 1_555 SD ? A MET 91 ? A MET 92 ? 1_555 89.5 ? 5 SG ? A CYS 83 ? A CYS 84 ? 1_555 CU ? B CU . ? A CU 100 ? 1_555 SD ? A MET 91 ? A MET 92 ? 1_555 113.0 ? 6 ND1 ? A HIS 86 ? A HIS 87 ? 1_555 CU ? B CU . ? A CU 100 ? 1_555 SD ? A MET 91 ? A MET 92 ? 1_555 104.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-08-20 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-11-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.0 ? 1 X-PLOR refinement 3.0 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 X-PLOR phasing 3.0 ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 62 ? ? CG A TYR 62 ? ? CD2 A TYR 62 ? ? 115.95 121.00 -5.05 0.60 N 2 1 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH2 A ARG 72 ? ? 116.91 120.30 -3.39 0.50 N 3 1 CB A TYR 80 ? ? CG A TYR 80 ? ? CD2 A TYR 80 ? ? 117.09 121.00 -3.91 0.60 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 32 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -120.01 _pdbx_validate_torsion.psi -51.77 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'SULFATE ION' SO4 4 water HOH #