data_1IVM # _entry.id 1IVM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1IVM RCSB RCSB005314 WWPDB D_1000005314 # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 4751 _pdbx_database_related.details '4751 contains the chemical shifts of the protein.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IVM _pdbx_database_status.recvd_initial_deposition_date 2002-03-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ueda, T.' 1 'Obita, T.' 2 'Imoto, T.' 3 # _citation.id primary _citation.title 'Solution structure and activity of mouse lysozyme M' _citation.journal_abbrev 'CELL.MOL.LIFE SCI.' _citation.journal_volume 60 _citation.page_first 176 _citation.page_last 184 _citation.year 2003 _citation.journal_id_ASTM ? _citation.country SZ _citation.journal_id_ISSN 1420-682X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12613666 _citation.pdbx_database_id_DOI 10.1007/s000180300012 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Obita, T.' 1 primary 'Ueda, T.' 2 primary 'Imoto, T.' 3 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'lysozyme M' _entity.formula_weight 14839.637 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.17 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lysozyme C, type M' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRATNYNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGIN CSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRAHCQNRDLSQYIRNCGV ; _entity_poly.pdbx_seq_one_letter_code_can ;KVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRATNYNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGIN CSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRAHCQNRDLSQYIRNCGV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 VAL n 1 3 TYR n 1 4 GLU n 1 5 ARG n 1 6 CYS n 1 7 GLU n 1 8 PHE n 1 9 ALA n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 LYS n 1 14 ARG n 1 15 ASN n 1 16 GLY n 1 17 MET n 1 18 ALA n 1 19 GLY n 1 20 TYR n 1 21 TYR n 1 22 GLY n 1 23 VAL n 1 24 SER n 1 25 LEU n 1 26 ALA n 1 27 ASP n 1 28 TRP n 1 29 VAL n 1 30 CYS n 1 31 LEU n 1 32 ALA n 1 33 GLN n 1 34 HIS n 1 35 GLU n 1 36 SER n 1 37 ASN n 1 38 TYR n 1 39 ASN n 1 40 THR n 1 41 ARG n 1 42 ALA n 1 43 THR n 1 44 ASN n 1 45 TYR n 1 46 ASN n 1 47 ARG n 1 48 GLY n 1 49 ASP n 1 50 GLN n 1 51 SER n 1 52 THR n 1 53 ASP n 1 54 TYR n 1 55 GLY n 1 56 ILE n 1 57 PHE n 1 58 GLN n 1 59 ILE n 1 60 ASN n 1 61 SER n 1 62 ARG n 1 63 TYR n 1 64 TRP n 1 65 CYS n 1 66 ASN n 1 67 ASP n 1 68 GLY n 1 69 LYS n 1 70 THR n 1 71 PRO n 1 72 ARG n 1 73 ALA n 1 74 VAL n 1 75 ASN n 1 76 ALA n 1 77 CYS n 1 78 GLY n 1 79 ILE n 1 80 ASN n 1 81 CYS n 1 82 SER n 1 83 ALA n 1 84 LEU n 1 85 LEU n 1 86 GLN n 1 87 ASP n 1 88 ASP n 1 89 ILE n 1 90 THR n 1 91 ALA n 1 92 ALA n 1 93 ILE n 1 94 GLN n 1 95 CYS n 1 96 ALA n 1 97 LYS n 1 98 ARG n 1 99 VAL n 1 100 VAL n 1 101 ARG n 1 102 ASP n 1 103 PRO n 1 104 GLN n 1 105 GLY n 1 106 ILE n 1 107 ARG n 1 108 ALA n 1 109 TRP n 1 110 VAL n 1 111 ALA n 1 112 TRP n 1 113 ARG n 1 114 ALA n 1 115 HIS n 1 116 CYS n 1 117 GLN n 1 118 ASN n 1 119 ARG n 1 120 ASP n 1 121 LEU n 1 122 SER n 1 123 GLN n 1 124 TYR n 1 125 ILE n 1 126 ARG n 1 127 ASN n 1 128 CYS n 1 129 GLY n 1 130 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus Pichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET21d(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYSCM_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRATNYNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGIN CSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRAHCQNRDLSQYIRNCGV ; _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_accession P08905 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IVM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08905 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM mouse lysozyme U-15N; non-buffer' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1IVM _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1IVM _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1IVM _pdbx_nmr_representative.conformer_id 20 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' 'Guentert, P.' 1 DYANA 1.5 refinement 'Guentert, P.' 2 # _exptl.entry_id 1IVM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1IVM _struct.title 'Solution structure of mouse lysozyme M' _struct.pdbx_descriptor 'lysozyme M(E.C.3.2.1.17)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IVM _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Hydrolase, Glycosidase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 4 ? GLY A 16 ? GLU A 4 GLY A 16 1 ? 13 HELX_P HELX_P2 2 SER A 24 ? SER A 36 ? SER A 24 SER A 36 1 ? 13 HELX_P HELX_P3 3 ARG A 47 ? GLN A 50 ? ARG A 47 GLN A 50 5 ? 4 HELX_P HELX_P4 4 ASN A 80 ? LEU A 85 ? ASN A 80 LEU A 85 5 ? 6 HELX_P HELX_P5 5 ILE A 89 ? ARG A 101 ? ILE A 89 ARG A 101 1 ? 13 HELX_P HELX_P6 6 GLY A 105 ? ALA A 108 ? GLY A 105 ALA A 108 5 ? 4 HELX_P HELX_P7 7 TRP A 109 ? ALA A 114 ? TRP A 109 ALA A 114 1 ? 6 HELX_P HELX_P8 8 LEU A 121 ? ARG A 126 ? LEU A 121 ARG A 126 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 128 SG ? ? A CYS 6 A CYS 128 1_555 ? ? ? ? ? ? ? 2.112 ? disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 30 A CYS 116 1_555 ? ? ? ? ? ? ? 2.138 ? disulf3 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 65 A CYS 81 1_555 ? ? ? ? ? ? ? 1.972 ? disulf4 disulf ? ? A CYS 77 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 77 A CYS 95 1_555 ? ? ? ? ? ? ? 2.050 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 2 ? TYR A 3 ? VAL A 2 TYR A 3 A 2 TYR A 38 ? ASN A 39 ? TYR A 38 ASN A 39 B 1 THR A 43 ? ASN A 46 ? THR A 43 ASN A 46 B 2 SER A 51 ? TYR A 54 ? SER A 51 TYR A 54 B 3 ILE A 59 ? ASN A 60 ? ILE A 59 ASN A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 3 ? N TYR A 3 O TYR A 38 ? O TYR A 38 B 1 2 N ASN A 44 ? N ASN A 44 O ASP A 53 ? O ASP A 53 B 2 3 N TYR A 54 ? N TYR A 54 O ILE A 59 ? O ILE A 59 # _database_PDB_matrix.entry_id 1IVM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IVM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 TRP 112 112 112 TRP TRP A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 VAL 130 130 130 VAL VAL A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-05-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A TYR 3 ? ? O A TYR 38 ? ? 1.44 2 1 O A ARG 47 ? ? H A GLN 50 ? ? 1.50 3 1 O A ILE 106 ? ? H A TRP 109 ? ? 1.52 4 1 O A TRP 28 ? ? H A ALA 32 ? ? 1.53 5 1 O A THR 52 ? ? H A SER 61 ? ? 1.55 6 1 O A ASN 44 ? ? H A ASP 53 ? ? 1.55 7 1 O A SER 82 ? ? H A LEU 85 ? ? 1.59 8 2 O A ARG 47 ? ? H A GLN 50 ? ? 1.52 9 2 O A ILE 106 ? ? H A TRP 109 ? ? 1.53 10 2 O A THR 52 ? ? H A SER 61 ? ? 1.53 11 2 H A TYR 3 ? ? O A TYR 38 ? ? 1.55 12 2 O A ASN 37 ? ? H A ASN 39 ? ? 1.57 13 2 O A TRP 28 ? ? H A ALA 32 ? ? 1.59 14 3 O A ARG 41 ? ? HG1 A THR 43 ? ? 1.40 15 3 O A THR 52 ? ? H A SER 61 ? ? 1.44 16 3 O A ASN 44 ? ? H A ASP 53 ? ? 1.49 17 3 O A ARG 47 ? ? H A GLN 50 ? ? 1.50 18 3 O A ASN 37 ? ? H A ASN 39 ? ? 1.52 19 3 O A ASN 80 ? ? H A ALA 83 ? ? 1.53 20 3 O A ILE 106 ? ? H A TRP 109 ? ? 1.53 21 3 O A VAL 74 ? ? H A ALA 76 ? ? 1.60 22 3 H A SER 24 ? ? OD2 A ASP 27 ? ? 1.60 23 4 O A ILE 106 ? ? H A TRP 109 ? ? 1.50 24 4 O A ASN 37 ? ? H A ASN 39 ? ? 1.50 25 4 O A PHE 8 ? ? H A LEU 12 ? ? 1.53 26 4 O A ARG 47 ? ? H A GLN 50 ? ? 1.54 27 4 O A THR 52 ? ? H A SER 61 ? ? 1.57 28 4 H A TYR 3 ? ? O A TYR 38 ? ? 1.57 29 4 O A GLY 55 ? ? H A GLN 58 ? ? 1.57 30 4 O A ARG 5 ? ? H A ALA 9 ? ? 1.60 31 5 O A TRP 28 ? ? H A ALA 32 ? ? 1.50 32 5 O A GLY 55 ? ? H A GLN 58 ? ? 1.51 33 5 O A ASN 44 ? ? H A ASP 53 ? ? 1.53 34 5 O A CYS 81 ? ? H A LEU 84 ? ? 1.54 35 5 O A ALA 91 ? ? H A CYS 95 ? ? 1.54 36 5 O A ILE 106 ? ? H A TRP 109 ? ? 1.55 37 5 O A ARG 47 ? ? H A GLN 50 ? ? 1.56 38 5 O A TRP 112 ? ? H A CYS 116 ? ? 1.59 39 6 O A ARG 41 ? ? HG1 A THR 43 ? ? 1.40 40 6 O A THR 52 ? ? H A SER 61 ? ? 1.44 41 6 H A TYR 3 ? ? O A TYR 38 ? ? 1.50 42 6 O A ARG 47 ? ? H A GLN 50 ? ? 1.51 43 6 O A ASN 80 ? ? H A ALA 83 ? ? 1.53 44 6 O A CYS 81 ? ? H A LEU 84 ? ? 1.56 45 6 O A ILE 106 ? ? H A TRP 109 ? ? 1.57 46 6 O A TRP 112 ? ? H A CYS 116 ? ? 1.58 47 7 O A THR 52 ? ? H A SER 61 ? ? 1.45 48 7 O A ARG 47 ? ? H A GLN 50 ? ? 1.50 49 7 HH A TYR 3 ? ? O A ASP 87 ? ? 1.52 50 7 O A ASN 37 ? ? H A ASN 39 ? ? 1.53 51 7 O A ILE 106 ? ? H A TRP 109 ? ? 1.53 52 7 O A ASN 44 ? ? H A ASP 53 ? ? 1.55 53 7 O A TRP 28 ? ? H A ALA 32 ? ? 1.58 54 7 O A TRP 112 ? ? H A CYS 116 ? ? 1.59 55 8 O A ARG 41 ? ? HG1 A THR 43 ? ? 1.43 56 8 O A PHE 8 ? ? H A LEU 12 ? ? 1.45 57 8 O A THR 52 ? ? H A SER 61 ? ? 1.49 58 8 O A ARG 47 ? ? H A GLN 50 ? ? 1.49 59 8 O A ASN 44 ? ? H A ASP 53 ? ? 1.51 60 8 O A GLU 7 ? ? H A THR 11 ? ? 1.51 61 8 O A ASN 80 ? ? H A ALA 83 ? ? 1.56 62 8 O A ARG 126 ? ? HD21 A ASN 127 ? ? 1.57 63 8 O A ILE 106 ? ? H A TRP 109 ? ? 1.58 64 8 O A LEU 12 ? ? H A GLY 16 ? ? 1.60 65 9 OD1 A ASP 102 ? ? H A GLY 105 ? ? 1.46 66 9 O A THR 52 ? ? H A SER 61 ? ? 1.50 67 9 O A ASN 37 ? ? H A ASN 39 ? ? 1.51 68 9 O A LEU 25 ? ? H A VAL 29 ? ? 1.52 69 9 O A ALA 91 ? ? H A CYS 95 ? ? 1.52 70 9 O A ASN 80 ? ? H A ALA 83 ? ? 1.53 71 9 O A LEU 12 ? ? H A GLY 16 ? ? 1.53 72 9 O A GLY 55 ? ? H A GLN 58 ? ? 1.54 73 9 O A ILE 106 ? ? H A TRP 109 ? ? 1.54 74 9 O A GLU 7 ? ? H A THR 11 ? ? 1.56 75 9 O A ARG 47 ? ? H A GLN 50 ? ? 1.57 76 10 O A ASN 37 ? ? H A ASN 39 ? ? 1.51 77 10 H A TYR 3 ? ? O A TYR 38 ? ? 1.51 78 10 O A ASN 44 ? ? H A ASP 53 ? ? 1.52 79 10 O A ARG 47 ? ? H A GLN 50 ? ? 1.53 80 10 O A ILE 106 ? ? H A TRP 109 ? ? 1.55 81 10 O A TRP 28 ? ? H A ALA 32 ? ? 1.56 82 10 O A ALA 111 ? ? H A ALA 114 ? ? 1.57 83 10 O A THR 52 ? ? H A SER 61 ? ? 1.57 84 11 O A ILE 106 ? ? H A TRP 109 ? ? 1.44 85 11 O A ASN 37 ? ? H A ASN 39 ? ? 1.47 86 11 O A CYS 116 ? ? H A ASN 118 ? ? 1.48 87 11 O A ARG 47 ? ? H A GLN 50 ? ? 1.51 88 11 O A ASN 44 ? ? H A ASP 53 ? ? 1.52 89 11 O A GLY 55 ? ? H A GLN 58 ? ? 1.53 90 11 O A THR 52 ? ? H A SER 61 ? ? 1.54 91 11 O A ALA 91 ? ? H A CYS 95 ? ? 1.55 92 11 H A TYR 3 ? ? O A TYR 38 ? ? 1.55 93 11 O A ASN 80 ? ? H A ALA 83 ? ? 1.59 94 11 O A LEU 12 ? ? H A GLY 16 ? ? 1.60 95 12 O A ARG 47 ? ? H A GLN 50 ? ? 1.48 96 12 O A ASN 44 ? ? H A ASP 53 ? ? 1.49 97 12 O A ARG 5 ? ? H A ALA 9 ? ? 1.52 98 12 O A ILE 106 ? ? H A TRP 109 ? ? 1.53 99 12 O A PHE 8 ? ? H A LEU 12 ? ? 1.56 100 12 O A THR 52 ? ? H A SER 61 ? ? 1.56 101 12 O A VAL 74 ? ? H A ALA 76 ? ? 1.60 102 13 O A THR 52 ? ? H A SER 61 ? ? 1.43 103 13 O A ILE 106 ? ? H A TRP 109 ? ? 1.53 104 13 O A GLY 55 ? ? H A GLN 58 ? ? 1.54 105 13 O A CYS 81 ? ? H A LEU 84 ? ? 1.55 106 13 O A ARG 47 ? ? H A GLN 50 ? ? 1.55 107 14 O A ASN 44 ? ? H A ASP 53 ? ? 1.50 108 14 O A ASN 37 ? ? H A ASN 39 ? ? 1.52 109 14 O A ASP 27 ? ? H A LEU 31 ? ? 1.53 110 14 O A THR 52 ? ? H A SER 61 ? ? 1.55 111 14 O A GLY 105 ? ? H A ALA 108 ? ? 1.55 112 14 O A ARG 47 ? ? H A GLN 50 ? ? 1.55 113 14 O A CYS 116 ? ? H A ASN 118 ? ? 1.60 114 14 O A ILE 106 ? ? H A TRP 109 ? ? 1.60 115 15 O A ILE 106 ? ? H A TRP 109 ? ? 1.48 116 15 O A ARG 47 ? ? H A GLN 50 ? ? 1.50 117 15 O A ARG 41 ? ? HG1 A THR 43 ? ? 1.51 118 15 O A PHE 8 ? ? H A LEU 12 ? ? 1.52 119 15 O A GLY 55 ? ? H A GLN 58 ? ? 1.53 120 15 O A ASN 37 ? ? H A ASN 39 ? ? 1.54 121 15 O A ASN 44 ? ? H A ASP 53 ? ? 1.57 122 16 O A ARG 41 ? ? HG1 A THR 43 ? ? 1.45 123 16 O A ASN 44 ? ? H A ASP 53 ? ? 1.50 124 16 O A ASP 27 ? ? H A LEU 31 ? ? 1.54 125 16 O A ARG 47 ? ? H A GLN 50 ? ? 1.55 126 16 O A TYR 63 ? ? H A ALA 76 ? ? 1.58 127 16 O A THR 52 ? ? H A SER 61 ? ? 1.60 128 17 H A TYR 3 ? ? O A TYR 38 ? ? 1.40 129 17 O A ILE 106 ? ? H A TRP 109 ? ? 1.48 130 17 O A THR 52 ? ? H A SER 61 ? ? 1.50 131 17 O A ARG 47 ? ? H A GLN 50 ? ? 1.50 132 17 O A ASN 44 ? ? H A ASP 53 ? ? 1.52 133 17 O A ALA 91 ? ? H A CYS 95 ? ? 1.57 134 17 O A TRP 28 ? ? H A ALA 32 ? ? 1.57 135 17 O A SER 82 ? ? H A LEU 85 ? ? 1.58 136 18 O A ARG 47 ? ? H A GLN 50 ? ? 1.49 137 18 O A ASN 44 ? ? H A ASP 53 ? ? 1.53 138 18 O A ASN 80 ? ? H A ALA 83 ? ? 1.54 139 18 O A THR 52 ? ? H A SER 61 ? ? 1.56 140 18 O A ILE 106 ? ? H A TRP 109 ? ? 1.57 141 18 O A GLY 105 ? ? H A ALA 108 ? ? 1.60 142 18 H A TYR 3 ? ? O A TYR 38 ? ? 1.60 143 19 HH A TYR 3 ? ? O A ASP 87 ? ? 1.42 144 19 O A CYS 116 ? ? H A ASN 118 ? ? 1.43 145 19 O A ASN 37 ? ? H A ASN 39 ? ? 1.46 146 19 O A THR 52 ? ? H A SER 61 ? ? 1.50 147 19 O A LEU 25 ? ? H A VAL 29 ? ? 1.51 148 19 O A ILE 106 ? ? H A TRP 109 ? ? 1.52 149 19 O A ASN 44 ? ? H A ASP 53 ? ? 1.54 150 19 O A ARG 5 ? ? H A ALA 9 ? ? 1.55 151 19 H A LYS 1 ? ? OG1 A THR 40 ? ? 1.57 152 20 H A TYR 54 ? ? O A ILE 59 ? ? 1.44 153 20 O A THR 52 ? ? H A SER 61 ? ? 1.45 154 20 O A ASP 27 ? ? H A LEU 31 ? ? 1.55 155 20 O A ILE 106 ? ? H A TRP 109 ? ? 1.57 156 20 O A CYS 116 ? ? H A ASN 118 ? ? 1.59 157 20 H A TYR 3 ? ? O A TYR 38 ? ? 1.59 158 20 O A TRP 112 ? ? H A HIS 115 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 6 ? ? -48.09 -75.27 2 1 ALA A 18 ? ? -52.04 109.93 3 1 TYR A 20 ? ? -43.31 168.56 4 1 SER A 36 ? ? 158.29 62.28 5 1 ASN A 37 ? ? -58.70 -150.98 6 1 TYR A 38 ? ? 72.66 -125.71 7 1 ALA A 42 ? ? -57.16 91.96 8 1 ASN A 46 ? ? -162.77 104.75 9 1 GLN A 50 ? ? 35.14 47.14 10 1 GLN A 58 ? ? 37.51 69.77 11 1 TYR A 63 ? ? -151.98 -44.61 12 1 CYS A 65 ? ? 52.42 176.42 13 1 ASP A 67 ? ? -150.37 -51.73 14 1 ARG A 72 ? ? -149.96 -45.61 15 1 ALA A 73 ? ? -40.83 159.49 16 1 ASN A 75 ? ? -39.32 100.07 17 1 ILE A 106 ? ? -39.68 -31.59 18 1 ARG A 107 ? ? -38.46 -38.75 19 1 HIS A 115 ? ? -150.73 -44.21 20 1 ASN A 118 ? ? -141.57 -57.16 21 1 ASN A 127 ? ? 161.27 -26.62 22 2 CYS A 6 ? ? -55.38 -76.54 23 2 TYR A 20 ? ? -48.60 177.16 24 2 SER A 36 ? ? 159.39 60.57 25 2 ASN A 37 ? ? -57.64 -158.79 26 2 TYR A 38 ? ? 67.19 -58.57 27 2 ASN A 46 ? ? -162.13 104.63 28 2 GLN A 50 ? ? 34.09 56.44 29 2 GLN A 58 ? ? 37.83 74.30 30 2 CYS A 65 ? ? 59.33 159.42 31 2 ASP A 67 ? ? -157.04 -47.07 32 2 ARG A 72 ? ? -149.33 -53.16 33 2 ALA A 73 ? ? -44.03 156.69 34 2 ASN A 75 ? ? -39.93 98.32 35 2 ASP A 87 ? ? -90.36 -73.71 36 2 ARG A 107 ? ? -38.31 -39.39 37 2 HIS A 115 ? ? -149.99 -45.66 38 2 ASN A 118 ? ? -147.75 -65.36 39 2 ASN A 127 ? ? 162.55 -27.21 40 3 CYS A 6 ? ? -53.21 -74.32 41 3 MET A 17 ? ? -131.06 -40.76 42 3 TYR A 20 ? ? -48.43 178.60 43 3 SER A 36 ? ? 160.29 51.18 44 3 ASN A 37 ? ? -61.07 -151.60 45 3 TYR A 38 ? ? 61.24 -63.38 46 3 ALA A 42 ? ? -44.91 104.92 47 3 ASN A 46 ? ? -163.56 106.07 48 3 GLN A 50 ? ? 34.76 51.30 49 3 GLN A 58 ? ? 36.96 66.01 50 3 TYR A 63 ? ? -158.03 -37.51 51 3 CYS A 65 ? ? 59.10 154.23 52 3 ASP A 67 ? ? -162.32 -45.37 53 3 ARG A 72 ? ? -150.81 -44.81 54 3 ALA A 73 ? ? -49.87 179.22 55 3 ASN A 75 ? ? -67.95 62.89 56 3 GLN A 86 ? ? -106.14 -157.22 57 3 TRP A 109 ? ? -97.65 43.90 58 3 HIS A 115 ? ? -151.87 -48.70 59 3 GLN A 117 ? ? -37.67 -30.43 60 3 ARG A 119 ? ? -129.06 -168.86 61 4 CYS A 6 ? ? -44.38 -72.05 62 4 TYR A 20 ? ? -49.43 179.13 63 4 SER A 36 ? ? 158.51 64.38 64 4 ASN A 37 ? ? -64.20 -155.31 65 4 TYR A 38 ? ? 62.40 -61.68 66 4 THR A 40 ? ? -103.36 49.12 67 4 ALA A 42 ? ? -40.15 101.35 68 4 ASN A 46 ? ? -160.87 103.67 69 4 GLN A 50 ? ? 36.44 50.13 70 4 GLN A 58 ? ? 40.65 77.80 71 4 CYS A 65 ? ? 61.70 147.11 72 4 ASN A 66 ? ? -89.99 -94.63 73 4 ASP A 67 ? ? 176.24 -43.70 74 4 LYS A 69 ? ? -135.50 -46.21 75 4 ARG A 72 ? ? -121.15 -58.02 76 4 ALA A 73 ? ? -39.93 138.83 77 4 VAL A 74 ? ? -90.10 56.99 78 4 ASN A 75 ? ? -38.96 96.82 79 4 LEU A 85 ? ? -142.00 25.65 80 4 ASP A 87 ? ? -88.20 -71.54 81 4 TRP A 109 ? ? -102.81 66.89 82 4 HIS A 115 ? ? -149.89 -45.46 83 4 ASN A 127 ? ? 161.69 -27.12 84 5 CYS A 6 ? ? -56.15 -77.09 85 5 TYR A 20 ? ? -47.53 178.37 86 5 SER A 36 ? ? -176.76 -62.28 87 5 ASN A 37 ? ? 55.94 -169.71 88 5 TYR A 38 ? ? 60.30 -74.11 89 5 ALA A 42 ? ? -51.86 92.35 90 5 ASN A 46 ? ? -161.66 103.76 91 5 GLN A 50 ? ? 36.14 61.12 92 5 GLN A 58 ? ? 38.52 85.31 93 5 CYS A 65 ? ? 60.36 153.12 94 5 ARG A 72 ? ? -135.40 -51.25 95 5 ALA A 73 ? ? -44.59 159.23 96 5 ASN A 75 ? ? -51.83 93.22 97 5 LEU A 85 ? ? -141.86 15.09 98 5 GLN A 86 ? ? -102.23 -168.96 99 5 ASP A 87 ? ? -83.83 -70.72 100 5 TRP A 109 ? ? -100.98 63.62 101 5 VAL A 110 ? ? -39.53 -31.05 102 5 HIS A 115 ? ? -150.65 -47.27 103 5 ASN A 118 ? ? -146.74 -65.92 104 5 ASN A 127 ? ? 171.62 -28.47 105 6 CYS A 6 ? ? -49.58 -80.65 106 6 TYR A 20 ? ? -48.61 177.90 107 6 SER A 36 ? ? -162.86 -68.43 108 6 ASN A 37 ? ? 74.98 171.16 109 6 TYR A 38 ? ? 59.00 -111.34 110 6 ALA A 42 ? ? -47.72 103.52 111 6 ASN A 46 ? ? -160.30 103.47 112 6 GLN A 50 ? ? 34.24 60.44 113 6 GLN A 58 ? ? 49.73 79.63 114 6 TYR A 63 ? ? -126.90 -52.89 115 6 CYS A 65 ? ? 60.01 152.30 116 6 ASN A 66 ? ? -96.20 -96.50 117 6 ASP A 67 ? ? 173.54 -47.24 118 6 ARG A 72 ? ? -141.51 -55.59 119 6 ALA A 73 ? ? -38.41 137.36 120 6 ASN A 75 ? ? -44.32 95.39 121 6 TRP A 109 ? ? -102.41 64.56 122 6 HIS A 115 ? ? -150.55 -44.65 123 6 ASN A 118 ? ? -61.10 -71.76 124 7 CYS A 6 ? ? -54.01 -79.01 125 7 TYR A 20 ? ? -49.22 -178.55 126 7 SER A 36 ? ? -163.99 -67.70 127 7 ASN A 37 ? ? 66.76 176.06 128 7 TYR A 38 ? ? 62.45 -62.67 129 7 THR A 40 ? ? -108.16 47.09 130 7 ASN A 46 ? ? -161.81 103.79 131 7 GLN A 50 ? ? 33.49 54.91 132 7 CYS A 65 ? ? 55.71 167.02 133 7 ASP A 67 ? ? -121.97 -52.82 134 7 ARG A 72 ? ? -145.07 -50.30 135 7 ALA A 73 ? ? -42.72 164.14 136 7 ASN A 75 ? ? -50.26 96.80 137 7 ARG A 107 ? ? -39.41 -35.79 138 7 TRP A 109 ? ? -90.48 57.12 139 7 HIS A 115 ? ? -150.60 -45.41 140 7 ASN A 118 ? ? -146.06 -61.63 141 7 ASN A 127 ? ? 82.46 29.81 142 8 CYS A 6 ? ? -46.93 -73.80 143 8 TYR A 20 ? ? -47.92 178.54 144 8 SER A 36 ? ? -164.07 -67.27 145 8 ASN A 37 ? ? 73.69 170.92 146 8 TYR A 38 ? ? 69.42 -58.19 147 8 ALA A 42 ? ? -52.11 103.99 148 8 GLN A 50 ? ? 32.91 44.88 149 8 TYR A 63 ? ? -126.22 -54.96 150 8 CYS A 65 ? ? 58.21 160.69 151 8 ASP A 67 ? ? -137.43 -51.17 152 8 ARG A 72 ? ? -132.54 -50.21 153 8 ALA A 73 ? ? -44.85 167.27 154 8 ASN A 75 ? ? -41.24 96.03 155 8 LEU A 85 ? ? -90.67 -75.02 156 8 GLN A 86 ? ? -143.94 31.94 157 8 ASP A 87 ? ? -90.02 -67.71 158 8 HIS A 115 ? ? -146.63 -46.38 159 8 ASN A 118 ? ? -144.83 -58.38 160 8 ASN A 127 ? ? 163.68 -27.59 161 9 CYS A 6 ? ? -45.82 -75.29 162 9 ALA A 18 ? ? -49.24 95.24 163 9 TYR A 20 ? ? -47.25 177.77 164 9 SER A 36 ? ? -171.78 -64.80 165 9 ASN A 37 ? ? 65.42 179.16 166 9 TYR A 38 ? ? 61.30 -62.95 167 9 THR A 40 ? ? -98.15 55.15 168 9 ALA A 42 ? ? -40.49 98.45 169 9 ASN A 44 ? ? -150.41 89.12 170 9 ASN A 46 ? ? -162.03 104.03 171 9 GLN A 50 ? ? 34.18 53.55 172 9 GLN A 58 ? ? 39.66 77.05 173 9 TYR A 63 ? ? -123.47 -60.56 174 9 CYS A 65 ? ? 60.09 154.87 175 9 ARG A 72 ? ? -149.44 -62.49 176 9 ALA A 73 ? ? -44.84 162.65 177 9 ASN A 75 ? ? -43.08 96.88 178 9 LEU A 85 ? ? -145.07 16.43 179 9 ASP A 87 ? ? -79.17 -70.83 180 9 ASP A 102 ? ? -57.95 174.82 181 9 ARG A 107 ? ? -38.92 -38.40 182 9 HIS A 115 ? ? -150.46 -44.86 183 9 ASN A 127 ? ? 161.75 -27.02 184 10 CYS A 6 ? ? -58.27 -76.07 185 10 TYR A 20 ? ? -48.86 179.76 186 10 SER A 36 ? ? 159.57 52.83 187 10 ASN A 37 ? ? -59.23 -157.08 188 10 TYR A 38 ? ? 61.67 -62.48 189 10 ALA A 42 ? ? -54.31 93.86 190 10 ASN A 46 ? ? -162.49 106.45 191 10 GLN A 50 ? ? 34.68 52.45 192 10 GLN A 58 ? ? 33.97 79.28 193 10 TYR A 63 ? ? -135.46 -44.74 194 10 CYS A 65 ? ? 60.61 146.65 195 10 ASP A 67 ? ? -136.50 -58.90 196 10 ARG A 72 ? ? -135.32 -46.82 197 10 ALA A 73 ? ? -41.20 160.30 198 10 ASN A 75 ? ? -40.12 99.42 199 10 ASP A 87 ? ? -90.61 -71.55 200 10 HIS A 115 ? ? -150.72 -43.03 201 10 ASN A 118 ? ? -128.88 -66.99 202 10 ARG A 119 ? ? -127.22 -168.20 203 10 ASN A 127 ? ? 162.35 -28.40 204 11 CYS A 6 ? ? -53.09 -76.51 205 11 ALA A 18 ? ? -50.62 108.75 206 11 TYR A 20 ? ? -47.76 176.41 207 11 SER A 36 ? ? -174.69 -63.57 208 11 ASN A 37 ? ? 65.69 -175.75 209 11 TYR A 38 ? ? 62.14 -60.02 210 11 THR A 40 ? ? -102.03 51.18 211 11 ALA A 42 ? ? -45.92 96.79 212 11 ASN A 46 ? ? -161.73 103.37 213 11 GLN A 50 ? ? 35.95 53.47 214 11 GLN A 58 ? ? 38.53 82.43 215 11 TYR A 63 ? ? -150.32 -48.31 216 11 CYS A 65 ? ? 61.83 140.77 217 11 ASP A 67 ? ? -132.92 -47.23 218 11 ARG A 72 ? ? -134.85 -56.86 219 11 ALA A 73 ? ? -41.45 160.38 220 11 ASN A 75 ? ? -38.09 97.98 221 11 ASP A 87 ? ? -82.55 -71.28 222 11 ARG A 107 ? ? -35.28 -34.54 223 11 TRP A 109 ? ? -104.62 50.31 224 11 HIS A 115 ? ? -152.56 -46.89 225 11 GLN A 117 ? ? -63.51 59.75 226 11 ASN A 118 ? ? -156.88 -44.97 227 11 ASN A 127 ? ? 160.49 -26.95 228 12 CYS A 6 ? ? -44.47 -81.46 229 12 TYR A 20 ? ? -49.22 179.62 230 12 SER A 36 ? ? -158.97 -70.17 231 12 ASN A 37 ? ? 67.32 172.33 232 12 TYR A 38 ? ? 71.62 -58.32 233 12 THR A 40 ? ? -111.21 67.56 234 12 ALA A 42 ? ? -40.46 102.76 235 12 ASN A 46 ? ? -161.60 104.88 236 12 GLN A 50 ? ? 35.09 53.98 237 12 GLN A 58 ? ? 38.81 67.36 238 12 TYR A 63 ? ? -151.18 -48.43 239 12 CYS A 65 ? ? 61.99 132.89 240 12 ASN A 66 ? ? -161.75 -166.75 241 12 ARG A 72 ? ? -140.22 -68.91 242 12 ALA A 73 ? ? -54.75 -173.49 243 12 ASN A 75 ? ? -67.36 63.70 244 12 GLN A 86 ? ? -119.74 -168.09 245 12 ILE A 106 ? ? -39.45 -30.56 246 12 HIS A 115 ? ? -150.84 -47.80 247 12 ASN A 118 ? ? -141.92 -62.83 248 12 ARG A 119 ? ? -124.57 -170.00 249 13 TYR A 3 ? ? -164.48 102.62 250 13 CYS A 6 ? ? -55.54 -80.98 251 13 TYR A 20 ? ? -46.94 177.29 252 13 VAL A 23 ? ? -45.00 105.29 253 13 SER A 36 ? ? 157.63 72.35 254 13 TYR A 38 ? ? 174.92 -33.91 255 13 ALA A 42 ? ? -38.86 106.98 256 13 ASN A 46 ? ? -162.47 104.74 257 13 GLN A 50 ? ? 34.96 55.97 258 13 GLN A 58 ? ? 40.40 71.57 259 13 TYR A 63 ? ? -106.65 -65.51 260 13 TRP A 64 ? ? -69.51 -125.56 261 13 CYS A 65 ? ? -36.11 150.90 262 13 ALA A 73 ? ? -57.82 -164.97 263 13 VAL A 74 ? ? -150.25 84.26 264 13 ASN A 75 ? ? -55.70 99.65 265 13 GLN A 86 ? ? -101.61 -164.55 266 13 ASP A 87 ? ? -90.59 -60.94 267 13 ARG A 107 ? ? -39.75 -36.30 268 13 HIS A 115 ? ? -150.61 -45.82 269 13 ASN A 118 ? ? -148.16 -58.22 270 13 ARG A 119 ? ? -129.42 -169.75 271 13 ASN A 127 ? ? 81.60 25.22 272 14 CYS A 6 ? ? -45.38 -74.15 273 14 ALA A 18 ? ? -43.16 105.00 274 14 TYR A 20 ? ? -44.22 174.45 275 14 TYR A 21 ? ? -35.63 -32.48 276 14 SER A 36 ? ? -166.44 -67.32 277 14 ASN A 37 ? ? 57.58 -164.24 278 14 TYR A 38 ? ? 62.81 -61.89 279 14 THR A 40 ? ? -69.68 57.01 280 14 ALA A 42 ? ? -54.25 98.39 281 14 ASN A 46 ? ? -161.34 105.04 282 14 GLN A 50 ? ? 36.66 47.42 283 14 GLN A 58 ? ? 39.04 66.92 284 14 TYR A 63 ? ? -134.53 -47.96 285 14 CYS A 65 ? ? 52.33 177.44 286 14 ASP A 67 ? ? -129.19 -50.35 287 14 LYS A 69 ? ? -145.36 35.94 288 14 ARG A 72 ? ? -150.47 -50.24 289 14 ASN A 75 ? ? -37.38 101.13 290 14 VAL A 110 ? ? -39.17 -35.92 291 14 HIS A 115 ? ? -150.82 -55.49 292 14 GLN A 117 ? ? -69.22 57.40 293 14 ASN A 118 ? ? -149.35 -50.56 294 14 ARG A 126 ? ? -63.31 99.56 295 14 ASN A 127 ? ? 161.71 -27.20 296 15 CYS A 6 ? ? -45.52 -79.18 297 15 GLU A 7 ? ? -28.92 -68.16 298 15 MET A 17 ? ? -149.38 -42.25 299 15 TYR A 20 ? ? -48.55 178.67 300 15 SER A 36 ? ? -154.90 -71.00 301 15 ASN A 37 ? ? 60.67 166.72 302 15 TYR A 38 ? ? 64.55 -60.78 303 15 ALA A 42 ? ? -55.09 107.19 304 15 GLN A 50 ? ? 34.32 55.55 305 15 GLN A 58 ? ? 41.82 84.57 306 15 TYR A 63 ? ? -131.40 -42.95 307 15 CYS A 65 ? ? 57.86 160.75 308 15 ASP A 67 ? ? -133.20 -56.58 309 15 ARG A 72 ? ? -135.52 -50.61 310 15 VAL A 74 ? ? -104.85 58.17 311 15 ASN A 75 ? ? -40.28 98.08 312 15 ASP A 87 ? ? -90.48 -64.17 313 15 ASP A 102 ? ? -53.30 177.54 314 15 GLN A 104 ? ? -52.63 -92.43 315 15 ILE A 106 ? ? -39.70 -29.12 316 15 ARG A 107 ? ? -37.73 -37.05 317 15 TRP A 109 ? ? -95.85 49.04 318 15 VAL A 110 ? ? -39.46 -29.98 319 15 HIS A 115 ? ? -151.76 -51.94 320 15 GLN A 117 ? ? -35.30 -32.18 321 15 ASN A 127 ? ? 82.26 26.93 322 16 CYS A 6 ? ? -55.08 -80.48 323 16 ALA A 18 ? ? -49.20 105.19 324 16 TYR A 20 ? ? -48.31 179.47 325 16 SER A 36 ? ? -170.50 -65.60 326 16 ASN A 37 ? ? 46.12 -159.37 327 16 TYR A 38 ? ? 58.58 -77.31 328 16 THR A 40 ? ? -91.38 51.42 329 16 ALA A 42 ? ? -54.93 93.14 330 16 GLN A 50 ? ? 36.37 40.87 331 16 GLN A 58 ? ? 37.46 64.82 332 16 TYR A 63 ? ? -143.34 -54.67 333 16 CYS A 65 ? ? 63.15 133.33 334 16 ASP A 67 ? ? 94.83 -10.95 335 16 LYS A 69 ? ? -150.99 -68.46 336 16 ALA A 73 ? ? -52.63 -174.37 337 16 VAL A 74 ? ? -116.24 73.25 338 16 ASN A 75 ? ? -55.33 100.68 339 16 GLN A 86 ? ? -118.06 -167.29 340 16 ILE A 106 ? ? -39.64 -29.83 341 16 TRP A 109 ? ? -92.12 56.19 342 16 VAL A 110 ? ? -34.66 -36.77 343 16 HIS A 115 ? ? -151.04 -54.59 344 16 GLN A 117 ? ? -69.47 57.54 345 16 ASN A 118 ? ? -147.73 -54.39 346 16 ASN A 127 ? ? 80.23 26.80 347 17 CYS A 6 ? ? -51.29 -80.80 348 17 TYR A 20 ? ? -46.33 176.11 349 17 SER A 36 ? ? 155.05 69.79 350 17 TYR A 38 ? ? 154.70 -124.94 351 17 ALA A 42 ? ? -53.53 98.64 352 17 ASN A 46 ? ? -162.05 105.21 353 17 GLN A 50 ? ? 31.87 47.48 354 17 GLN A 58 ? ? 38.80 67.94 355 17 TYR A 63 ? ? -139.76 -47.98 356 17 CYS A 65 ? ? 58.17 160.85 357 17 ASP A 67 ? ? -138.07 -55.63 358 17 ARG A 72 ? ? -138.18 -45.24 359 17 ALA A 73 ? ? -52.83 176.31 360 17 ASN A 75 ? ? -40.30 99.95 361 17 GLN A 86 ? ? -113.22 -157.32 362 17 PRO A 103 ? ? -75.00 49.08 363 17 GLN A 104 ? ? -140.31 -86.60 364 17 ILE A 106 ? ? -39.91 -29.23 365 17 ARG A 107 ? ? -33.77 -36.72 366 17 HIS A 115 ? ? -146.52 -46.14 367 17 ASN A 118 ? ? -146.84 -60.94 368 17 ARG A 119 ? ? -129.70 -169.91 369 17 ASN A 127 ? ? 160.67 -25.93 370 18 CYS A 6 ? ? -50.35 -78.24 371 18 ALA A 18 ? ? -52.10 102.24 372 18 TYR A 20 ? ? -47.49 177.40 373 18 SER A 36 ? ? -153.75 -71.80 374 18 ASN A 37 ? ? 71.63 170.93 375 18 TYR A 38 ? ? 60.57 -115.66 376 18 ALA A 42 ? ? -50.42 93.85 377 18 ASN A 46 ? ? -161.39 100.99 378 18 GLN A 50 ? ? 35.53 51.35 379 18 GLN A 58 ? ? 42.09 89.64 380 18 CYS A 65 ? ? 58.80 158.45 381 18 ASP A 67 ? ? -132.16 -46.39 382 18 ARG A 72 ? ? -135.62 -59.62 383 18 ALA A 73 ? ? -46.81 161.45 384 18 ASN A 75 ? ? -49.06 101.54 385 18 ASP A 87 ? ? -84.25 -72.05 386 18 HIS A 115 ? ? -149.83 -44.26 387 18 ARG A 119 ? ? -136.98 -158.42 388 19 CYS A 6 ? ? -46.57 -79.10 389 19 TYR A 20 ? ? -53.73 -172.26 390 19 TYR A 21 ? ? -36.23 -31.79 391 19 VAL A 23 ? ? -51.87 107.33 392 19 SER A 36 ? ? -175.69 -50.94 393 19 ASN A 37 ? ? 47.87 -173.88 394 19 TYR A 38 ? ? 62.38 -59.05 395 19 ALA A 42 ? ? -47.02 96.64 396 19 ASN A 46 ? ? -161.82 104.70 397 19 ASP A 49 ? ? -141.51 32.58 398 19 GLN A 50 ? ? 35.58 61.70 399 19 GLN A 58 ? ? 47.03 84.98 400 19 CYS A 65 ? ? 59.46 156.38 401 19 ASP A 67 ? ? -144.59 -54.63 402 19 ARG A 72 ? ? -141.17 -65.66 403 19 ASN A 75 ? ? -48.56 94.10 404 19 GLN A 86 ? ? -104.64 -167.15 405 19 ASP A 87 ? ? -89.81 -75.25 406 19 TRP A 109 ? ? -96.55 47.00 407 19 HIS A 115 ? ? -153.25 -51.13 408 19 GLN A 117 ? ? -59.27 61.97 409 19 ASN A 118 ? ? -155.45 -44.65 410 19 ARG A 119 ? ? -128.11 -169.58 411 19 ASN A 127 ? ? 162.42 -27.44 412 20 TYR A 3 ? ? -160.22 116.25 413 20 CYS A 6 ? ? -51.87 -78.68 414 20 ALA A 18 ? ? -50.27 109.80 415 20 TYR A 20 ? ? -50.38 -176.24 416 20 SER A 36 ? ? 179.07 -58.56 417 20 ASN A 37 ? ? 53.89 -164.88 418 20 TYR A 38 ? ? 56.77 -113.76 419 20 ALA A 42 ? ? -39.54 102.73 420 20 ASN A 46 ? ? -161.68 104.34 421 20 GLN A 50 ? ? 36.42 61.76 422 20 ILE A 56 ? ? -26.99 -41.94 423 20 PHE A 57 ? ? -148.09 29.20 424 20 GLN A 58 ? ? 37.25 53.06 425 20 CYS A 65 ? ? 61.79 143.19 426 20 ASN A 66 ? ? -80.28 -95.00 427 20 ASP A 67 ? ? 173.45 -46.84 428 20 LYS A 69 ? ? -137.80 -46.73 429 20 ARG A 72 ? ? -120.98 -54.48 430 20 ASN A 75 ? ? -38.96 97.02 431 20 GLN A 86 ? ? -109.84 -155.37 432 20 ASP A 87 ? ? -91.00 -73.13 433 20 TRP A 109 ? ? -93.31 50.15 434 20 VAL A 110 ? ? -34.53 -36.09 435 20 HIS A 115 ? ? -151.65 -51.95 436 20 GLN A 117 ? ? -68.58 58.14 437 20 ASN A 118 ? ? -145.25 -52.60 #