data_1IVN # _entry.id 1IVN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1IVN RCSB RCSB005315 WWPDB D_1000005315 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1J00 '1J00 is complexed with diethyl phosphono moiety structure.' unspecified PDB 1JRL '1JRL is L109P mutant.' unspecified PDB 1NYV '1NYV is complexed with octanoic acid.' unspecified # _pdbx_database_status.entry_id 1IVN _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2002-03-27 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lo, Y.-C.' 1 'Shaw, J.-F.' 2 'Liaw, Y.-C.' 3 # _citation.id primary _citation.title ;Crystal Structure of Escherichia coli Thioesterase I/Protease I/Lysophospholipase L1: Consensus Sequence Blocks Constitute the Catalytic Center of SGNH-hydrolases through a Conserved Hydrogen Bond Network ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 330 _citation.page_first 539 _citation.page_last 551 _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12842470 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(03)00637-5' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lo, Y.-C.' 1 primary 'Lin, S.-C.' 2 primary 'Shaw, J.-F.' 3 primary 'Liaw, Y.-C.' 4 # _cell.entry_id 1IVN _cell.length_a 49.936 _cell.length_b 49.936 _cell.length_c 170.364 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1IVN _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 96 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thioesterase I' 21561.414 1 '3.1.1.5, 3.1.2.-' ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 147 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Acyl-CoA thioesterase I, Protease I, Lysophospholipase L1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQ PQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNR DAQPFIADWMAKQLQPLVNHDSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;ADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQ PQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNR DAQPFIADWMAKQLQPLVNHDSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 THR n 1 4 LEU n 1 5 LEU n 1 6 ILE n 1 7 LEU n 1 8 GLY n 1 9 ASP n 1 10 SER n 1 11 LEU n 1 12 SER n 1 13 ALA n 1 14 GLY n 1 15 TYR n 1 16 ARG n 1 17 MET n 1 18 SER n 1 19 ALA n 1 20 SER n 1 21 ALA n 1 22 ALA n 1 23 TRP n 1 24 PRO n 1 25 ALA n 1 26 LEU n 1 27 LEU n 1 28 ASN n 1 29 ASP n 1 30 LYS n 1 31 TRP n 1 32 GLN n 1 33 SER n 1 34 LYS n 1 35 THR n 1 36 SER n 1 37 VAL n 1 38 VAL n 1 39 ASN n 1 40 ALA n 1 41 SER n 1 42 ILE n 1 43 SER n 1 44 GLY n 1 45 ASP n 1 46 THR n 1 47 SER n 1 48 GLN n 1 49 GLN n 1 50 GLY n 1 51 LEU n 1 52 ALA n 1 53 ARG n 1 54 LEU n 1 55 PRO n 1 56 ALA n 1 57 LEU n 1 58 LEU n 1 59 LYS n 1 60 GLN n 1 61 HIS n 1 62 GLN n 1 63 PRO n 1 64 ARG n 1 65 TRP n 1 66 VAL n 1 67 LEU n 1 68 VAL n 1 69 GLU n 1 70 LEU n 1 71 GLY n 1 72 GLY n 1 73 ASN n 1 74 ASP n 1 75 GLY n 1 76 LEU n 1 77 ARG n 1 78 GLY n 1 79 PHE n 1 80 GLN n 1 81 PRO n 1 82 GLN n 1 83 GLN n 1 84 THR n 1 85 GLU n 1 86 GLN n 1 87 THR n 1 88 LEU n 1 89 ARG n 1 90 GLN n 1 91 ILE n 1 92 LEU n 1 93 GLN n 1 94 ASP n 1 95 VAL n 1 96 LYS n 1 97 ALA n 1 98 ALA n 1 99 ASN n 1 100 ALA n 1 101 GLU n 1 102 PRO n 1 103 LEU n 1 104 LEU n 1 105 MET n 1 106 GLN n 1 107 ILE n 1 108 ARG n 1 109 LEU n 1 110 PRO n 1 111 ALA n 1 112 ASN n 1 113 TYR n 1 114 GLY n 1 115 ARG n 1 116 ARG n 1 117 TYR n 1 118 ASN n 1 119 GLU n 1 120 ALA n 1 121 PHE n 1 122 SER n 1 123 ALA n 1 124 ILE n 1 125 TYR n 1 126 PRO n 1 127 LYS n 1 128 LEU n 1 129 ALA n 1 130 LYS n 1 131 GLU n 1 132 PHE n 1 133 ASP n 1 134 VAL n 1 135 PRO n 1 136 LEU n 1 137 LEU n 1 138 PRO n 1 139 PHE n 1 140 PHE n 1 141 MET n 1 142 GLU n 1 143 GLU n 1 144 VAL n 1 145 TYR n 1 146 LEU n 1 147 LYS n 1 148 PRO n 1 149 GLN n 1 150 TRP n 1 151 MET n 1 152 GLN n 1 153 ASP n 1 154 ASP n 1 155 GLY n 1 156 ILE n 1 157 HIS n 1 158 PRO n 1 159 ASN n 1 160 ARG n 1 161 ASP n 1 162 ALA n 1 163 GLN n 1 164 PRO n 1 165 PHE n 1 166 ILE n 1 167 ALA n 1 168 ASP n 1 169 TRP n 1 170 MET n 1 171 ALA n 1 172 LYS n 1 173 GLN n 1 174 LEU n 1 175 GLN n 1 176 PRO n 1 177 LEU n 1 178 VAL n 1 179 ASN n 1 180 HIS n 1 181 ASP n 1 182 SER n 1 183 LEU n 1 184 GLU n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene tesA/apeA/pldC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plsmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-20b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TESA_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQ PQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNR DAQPFIADWMAKQLQPLVNHDS ; _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_accession P29679 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IVN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29679 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 208 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1IVN LEU A 183 ? UNP P29679 ? ? 'EXPRESSION TAG' 183 1 1 1IVN GLU A 184 ? UNP P29679 ? ? 'EXPRESSION TAG' 184 2 1 1IVN HIS A 185 ? UNP P29679 ? ? 'EXPRESSION TAG' 185 3 1 1IVN HIS A 186 ? UNP P29679 ? ? 'EXPRESSION TAG' 186 4 1 1IVN HIS A 187 ? UNP P29679 ? ? 'EXPRESSION TAG' 187 5 1 1IVN HIS A 188 ? UNP P29679 ? ? 'EXPRESSION TAG' 188 6 1 1IVN HIS A 189 ? UNP P29679 ? ? 'EXPRESSION TAG' 189 7 1 1IVN HIS A 190 ? UNP P29679 ? ? 'EXPRESSION TAG' 190 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1IVN _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 48.56 _exptl_crystal.density_Matthews 2.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '2-[N-morpholino]ethanesulfonic acid, PEGMME 5000, Ammonium sulfate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 133 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9236 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL38B1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9236 _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL38B1 # _reflns.entry_id 1IVN _reflns.d_resolution_high 1.90 _reflns.d_resolution_low 28.15 _reflns.limit_h_max 25 _reflns.limit_h_min 0 _reflns.limit_k_max 18 _reflns.limit_k_min 0 _reflns.limit_l_max 88 _reflns.limit_l_min 0 _reflns.number_all 17352 _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_F_max 706205.76 _reflns.observed_criterion_F_min 0.320000 _reflns.B_iso_Wilson_estimate 26.6 _reflns.observed_criterion_sigma_I 0.0 _reflns.number_obs 17352 _reflns.percent_possible_obs 97.0 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.9 _reflns.pdbx_redundancy 20.96 _reflns.R_free_details ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.97 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 87.2 _reflns_shell.Rmerge_I_obs 0.246 _reflns_shell.meanI_over_sigI_obs 4.94 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1IVN _refine.ls_number_reflns_all 17893 _refine.ls_number_reflns_obs 16976 _refine.ls_percent_reflns_obs 94.9 _refine.ls_d_res_high 1.90 _refine.ls_d_res_low 28.15 _refine.B_iso_min 22.55 _refine.B_iso_max 98.63 _refine.B_iso_mean 46.8 _refine.occupancy_min 1.00 _refine.occupancy_max 1.00 _refine.aniso_B[1][1] 8.73 _refine.aniso_B[2][2] 8.73 _refine.aniso_B[3][3] -17.46 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_param_bsol 52.2166 _refine.solvent_model_param_ksol 0.383183 _refine.solvent_model_details 'CNS bulk solvent model used' _refine.ls_R_factor_R_work 0.229 _refine.ls_R_factor_R_free 0.255 _refine.ls_R_factor_R_free_error 0.007 _refine.ls_number_reflns_R_free 1695 _refine.ls_percent_reflns_R_free 10.0 _refine.details ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB ENTRY 1JRL' _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_isotropic_thermal_model anisotropic _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1IVN _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.pdbx_Luzzati_d_res_high_obs 1.90 _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs 0.27 _refine_analyze.Luzzati_coordinate_error_free 0.30 _refine_analyze.Luzzati_sigma_a_free 0.27 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1416 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 147 _refine_hist.number_atoms_total 1574 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 28.15 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.006 . ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.1 . ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 21.3 . ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 0.79 . ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 1.64 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 2.75 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 2.00 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 3.06 2.50 ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_all 1.90 2.02 2909 2437 2212 83.7 0.324 0.313 0.022 225 7.7 6 . 'X-RAY DIFFRACTION' . 2.02 2.17 2923 2832 2578 96.9 0.283 0.34 0.018 254 8.7 6 . 'X-RAY DIFFRACTION' . 2.17 2.39 2925 2872 2577 98.2 0.251 0.29 0.015 295 10.1 6 . 'X-RAY DIFFRACTION' . 2.39 2.74 2952 2906 2604 98.4 0.24 0.286 0.014 302 10.2 6 . 'X-RAY DIFFRACTION' . 2.74 3.45 2989 2956 2638 98.9 0.244 0.283 0.014 318 10.6 6 . 'X-RAY DIFFRACTION' . 3.45 28.15 3209 2973 2672 92.6 0.222 0.263 0.013 301 9.4 6 . 'X-RAY DIFFRACTION' . # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' 4 imd.param imd.top 'X-RAY DIFFRACTION' 5 gol.param gol.top 'X-RAY DIFFRACTION' # _struct.entry_id 1IVN _struct.title 'E.coli Thioesterase I/Protease I/Lysophospholiase L1' _struct.pdbx_descriptor 'Thioesterase I(E.C.3.1.1.5, 3.1.2.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IVN _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Hydrolase, Protease' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 9 ? GLY A 14 ? ASP A 9 GLY A 14 1 ? 6 HELX_P HELX_P2 2 SER A 18 ? ALA A 21 ? SER A 18 ALA A 21 5 ? 4 HELX_P HELX_P3 3 ALA A 22 ? TRP A 31 ? ALA A 22 TRP A 31 1 ? 10 HELX_P HELX_P4 4 THR A 46 ? GLN A 62 ? THR A 46 GLN A 62 1 ? 17 HELX_P HELX_P5 5 GLN A 80 ? ALA A 98 ? GLN A 80 ALA A 98 1 ? 19 HELX_P HELX_P6 6 PRO A 110 ? TYR A 113 ? PRO A 110 TYR A 113 5 ? 4 HELX_P HELX_P7 7 GLY A 114 ? PHE A 132 ? GLY A 114 PHE A 132 1 ? 19 HELX_P HELX_P8 8 PHE A 140 ? LEU A 146 ? PHE A 140 LEU A 146 1 ? 7 HELX_P HELX_P9 9 LYS A 147 ? MET A 151 ? LYS A 147 MET A 151 5 ? 5 HELX_P HELX_P10 10 ASN A 159 ? ASP A 161 ? ASN A 159 ASP A 161 5 ? 3 HELX_P HELX_P11 11 ALA A 162 ? GLN A 175 ? ALA A 162 GLN A 175 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 35 ? ASN A 39 ? THR A 35 ASN A 39 A 2 ASP A 2 ? GLY A 8 ? ASP A 2 GLY A 8 A 3 TRP A 65 ? GLU A 69 ? TRP A 65 GLU A 69 A 4 GLU A 101 ? MET A 105 ? GLU A 101 MET A 105 A 5 LEU A 136 ? LEU A 137 ? LEU A 136 LEU A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 36 ? O SER A 36 N LEU A 4 ? N LEU A 4 A 2 3 N LEU A 7 ? N LEU A 7 O LEU A 67 ? O LEU A 67 A 3 4 N VAL A 66 ? N VAL A 66 O LEU A 103 ? O LEU A 103 A 4 5 N LEU A 104 ? N LEU A 104 O LEU A 137 ? O LEU A 137 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 A 501' AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 MET A 17 ? MET A 17 . ? 1_555 ? 2 AC1 8 SER A 18 ? SER A 18 . ? 1_555 ? 3 AC1 8 ALA A 21 ? ALA A 21 . ? 1_555 ? 4 AC1 8 ILE A 42 ? ILE A 42 . ? 8_665 ? 5 AC1 8 ARG A 53 ? ARG A 53 . ? 8_665 ? 6 AC1 8 LEU A 57 ? LEU A 57 . ? 8_665 ? 7 AC1 8 ARG A 160 ? ARG A 160 . ? 1_555 ? 8 AC1 8 HOH D . ? HOH A 531 . ? 1_555 ? 9 AC2 8 ASP A 9 ? ASP A 9 . ? 1_555 ? 10 AC2 8 SER A 10 ? SER A 10 . ? 1_555 ? 11 AC2 8 GLY A 72 ? GLY A 72 . ? 1_555 ? 12 AC2 8 ASN A 73 ? ASN A 73 . ? 1_555 ? 13 AC2 8 ARG A 108 ? ARG A 108 . ? 1_555 ? 14 AC2 8 ILE A 156 ? ILE A 156 . ? 1_555 ? 15 AC2 8 HOH D . ? HOH A 519 . ? 1_555 ? 16 AC2 8 HOH D . ? HOH A 533 . ? 1_555 ? # _atom_sites.entry_id 1IVN _atom_sites.fract_transf_matrix[1][1] 0.020026 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020026 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005870 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 GLN 32 32 ? ? ? A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 MET 141 141 141 MET MET A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 TRP 150 150 150 TRP TRP A . n A 1 151 MET 151 151 151 MET MET A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 TRP 169 169 169 TRP TRP A . n A 1 170 MET 170 170 170 MET MET A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 ASP 181 181 ? ? ? A . n A 1 182 SER 182 182 ? ? ? A . n A 1 183 LEU 183 183 ? ? ? A . n A 1 184 GLU 184 184 ? ? ? A . n A 1 185 HIS 185 185 ? ? ? A . n A 1 186 HIS 186 186 ? ? ? A . n A 1 187 HIS 187 187 ? ? ? A . n A 1 188 HIS 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n A 1 190 HIS 190 190 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PQS monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 2010 ? 2 MORE -48 ? 2 'SSA (A^2)' 16700 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 49.9360000000 -1.0000000000 0.0000000000 0.0000000000 49.9360000000 0.0000000000 0.0000000000 -1.0000000000 85.1820000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-07-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _refine_B_iso.class _refine_B_iso.treatment _refine_B_iso.pdbx_refine_id _refine_B_iso.details polymer isotropic 'X-RAY DIFFRACTION' ? water isotropic 'X-RAY DIFFRACTION' ? nonpolymer isotropic 'X-RAY DIFFRACTION' ? # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.location _software.classification _software.language _software.citation_id _software.pdbx_ordinal CNS 1.0 1998 package 'Axel T. Brunger' axel.brunger@@yale.edu . refinement Fortran ? 1 ADSC '(QUANTUM)' ? ? ? ? ? 'data collection' ? ? 2 SCALEPACK . ? ? ? ? ? 'data scaling' ? ? 3 CNS . ? ? ? ? ? phasing ? ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 547 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 636 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.00 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 9 ? ? -113.00 -148.38 2 1 ALA A 40 ? ? -95.49 52.75 3 1 GLN A 62 ? ? 39.70 57.92 4 1 ASP A 74 ? ? -71.74 32.89 5 1 ASN A 112 ? ? -72.51 29.33 6 1 ARG A 115 ? ? -70.76 -108.04 7 1 ARG A 116 ? ? -6.60 -53.73 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 180 ? N ? A HIS 180 N 2 1 Y 1 A HIS 180 ? CA ? A HIS 180 CA 3 1 Y 1 A HIS 180 ? C ? A HIS 180 C 4 1 Y 1 A HIS 180 ? O ? A HIS 180 O 5 1 Y 1 A HIS 180 ? CB ? A HIS 180 CB # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 32 ? A GLN 32 2 1 Y 1 A ASP 181 ? A ASP 181 3 1 Y 1 A SER 182 ? A SER 182 4 1 Y 1 A LEU 183 ? A LEU 183 5 1 Y 1 A GLU 184 ? A GLU 184 6 1 Y 1 A HIS 185 ? A HIS 185 7 1 Y 1 A HIS 186 ? A HIS 186 8 1 Y 1 A HIS 187 ? A HIS 187 9 1 Y 1 A HIS 188 ? A HIS 188 10 1 Y 1 A HIS 189 ? A HIS 189 11 1 Y 1 A HIS 190 ? A HIS 190 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 GLYCEROL GOL 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 501 501 SO4 SO4 A . C 3 GOL 1 301 301 GOL GOL A . D 4 HOH 1 502 1 HOH HOH A . D 4 HOH 2 503 2 HOH HOH A . D 4 HOH 3 504 3 HOH HOH A . D 4 HOH 4 505 4 HOH HOH A . D 4 HOH 5 506 5 HOH HOH A . D 4 HOH 6 507 6 HOH HOH A . D 4 HOH 7 508 7 HOH HOH A . D 4 HOH 8 509 8 HOH HOH A . D 4 HOH 9 510 9 HOH HOH A . D 4 HOH 10 511 10 HOH HOH A . D 4 HOH 11 512 11 HOH HOH A . D 4 HOH 12 513 12 HOH HOH A . D 4 HOH 13 514 13 HOH HOH A . D 4 HOH 14 515 14 HOH HOH A . D 4 HOH 15 516 15 HOH HOH A . D 4 HOH 16 517 16 HOH HOH A . D 4 HOH 17 518 17 HOH HOH A . D 4 HOH 18 519 18 HOH HOH A . D 4 HOH 19 520 19 HOH HOH A . D 4 HOH 20 521 20 HOH HOH A . D 4 HOH 21 522 21 HOH HOH A . D 4 HOH 22 523 22 HOH HOH A . D 4 HOH 23 524 23 HOH HOH A . D 4 HOH 24 525 24 HOH HOH A . D 4 HOH 25 526 25 HOH HOH A . D 4 HOH 26 527 26 HOH HOH A . D 4 HOH 27 528 27 HOH HOH A . D 4 HOH 28 529 28 HOH HOH A . D 4 HOH 29 530 29 HOH HOH A . D 4 HOH 30 531 30 HOH HOH A . D 4 HOH 31 532 31 HOH HOH A . D 4 HOH 32 533 32 HOH HOH A . D 4 HOH 33 534 33 HOH HOH A . D 4 HOH 34 535 34 HOH HOH A . D 4 HOH 35 536 35 HOH HOH A . D 4 HOH 36 537 36 HOH HOH A . D 4 HOH 37 538 37 HOH HOH A . D 4 HOH 38 539 38 HOH HOH A . D 4 HOH 39 540 39 HOH HOH A . D 4 HOH 40 541 40 HOH HOH A . D 4 HOH 41 542 41 HOH HOH A . D 4 HOH 42 543 42 HOH HOH A . D 4 HOH 43 544 43 HOH HOH A . D 4 HOH 44 545 44 HOH HOH A . D 4 HOH 45 546 45 HOH HOH A . D 4 HOH 46 547 46 HOH HOH A . D 4 HOH 47 548 47 HOH HOH A . D 4 HOH 48 549 48 HOH HOH A . D 4 HOH 49 550 49 HOH HOH A . D 4 HOH 50 551 50 HOH HOH A . D 4 HOH 51 552 51 HOH HOH A . D 4 HOH 52 553 52 HOH HOH A . D 4 HOH 53 554 53 HOH HOH A . D 4 HOH 54 555 54 HOH HOH A . D 4 HOH 55 556 55 HOH HOH A . D 4 HOH 56 557 56 HOH HOH A . D 4 HOH 57 558 57 HOH HOH A . D 4 HOH 58 559 58 HOH HOH A . D 4 HOH 59 560 59 HOH HOH A . D 4 HOH 60 561 60 HOH HOH A . D 4 HOH 61 562 61 HOH HOH A . D 4 HOH 62 563 62 HOH HOH A . D 4 HOH 63 564 63 HOH HOH A . D 4 HOH 64 565 64 HOH HOH A . D 4 HOH 65 566 65 HOH HOH A . D 4 HOH 66 567 66 HOH HOH A . D 4 HOH 67 568 67 HOH HOH A . D 4 HOH 68 569 68 HOH HOH A . D 4 HOH 69 570 69 HOH HOH A . D 4 HOH 70 571 70 HOH HOH A . D 4 HOH 71 572 71 HOH HOH A . D 4 HOH 72 573 72 HOH HOH A . D 4 HOH 73 574 73 HOH HOH A . D 4 HOH 74 575 74 HOH HOH A . D 4 HOH 75 576 75 HOH HOH A . D 4 HOH 76 577 76 HOH HOH A . D 4 HOH 77 578 77 HOH HOH A . D 4 HOH 78 579 78 HOH HOH A . D 4 HOH 79 580 79 HOH HOH A . D 4 HOH 80 581 80 HOH HOH A . D 4 HOH 81 582 81 HOH HOH A . D 4 HOH 82 583 82 HOH HOH A . D 4 HOH 83 584 83 HOH HOH A . D 4 HOH 84 585 84 HOH HOH A . D 4 HOH 85 586 85 HOH HOH A . D 4 HOH 86 587 86 HOH HOH A . D 4 HOH 87 588 87 HOH HOH A . D 4 HOH 88 589 88 HOH HOH A . D 4 HOH 89 590 89 HOH HOH A . D 4 HOH 90 591 90 HOH HOH A . D 4 HOH 91 592 91 HOH HOH A . D 4 HOH 92 593 92 HOH HOH A . D 4 HOH 93 594 93 HOH HOH A . D 4 HOH 94 595 94 HOH HOH A . D 4 HOH 95 596 95 HOH HOH A . D 4 HOH 96 597 96 HOH HOH A . D 4 HOH 97 598 97 HOH HOH A . D 4 HOH 98 599 98 HOH HOH A . D 4 HOH 99 600 99 HOH HOH A . D 4 HOH 100 601 100 HOH HOH A . D 4 HOH 101 602 101 HOH HOH A . D 4 HOH 102 603 102 HOH HOH A . D 4 HOH 103 604 103 HOH HOH A . D 4 HOH 104 605 104 HOH HOH A . D 4 HOH 105 606 105 HOH HOH A . D 4 HOH 106 607 106 HOH HOH A . D 4 HOH 107 608 107 HOH HOH A . D 4 HOH 108 609 108 HOH HOH A . D 4 HOH 109 610 109 HOH HOH A . D 4 HOH 110 611 110 HOH HOH A . D 4 HOH 111 612 111 HOH HOH A . D 4 HOH 112 613 112 HOH HOH A . D 4 HOH 113 614 113 HOH HOH A . D 4 HOH 114 615 114 HOH HOH A . D 4 HOH 115 616 115 HOH HOH A . D 4 HOH 116 617 116 HOH HOH A . D 4 HOH 117 618 117 HOH HOH A . D 4 HOH 118 619 118 HOH HOH A . D 4 HOH 119 620 119 HOH HOH A . D 4 HOH 120 621 120 HOH HOH A . D 4 HOH 121 622 121 HOH HOH A . D 4 HOH 122 623 122 HOH HOH A . D 4 HOH 123 624 123 HOH HOH A . D 4 HOH 124 625 124 HOH HOH A . D 4 HOH 125 626 125 HOH HOH A . D 4 HOH 126 627 126 HOH HOH A . D 4 HOH 127 628 127 HOH HOH A . D 4 HOH 128 629 128 HOH HOH A . D 4 HOH 129 630 129 HOH HOH A . D 4 HOH 130 631 130 HOH HOH A . D 4 HOH 131 632 131 HOH HOH A . D 4 HOH 132 633 132 HOH HOH A . D 4 HOH 133 634 133 HOH HOH A . D 4 HOH 134 635 134 HOH HOH A . D 4 HOH 135 636 135 HOH HOH A . D 4 HOH 136 637 136 HOH HOH A . D 4 HOH 137 638 137 HOH HOH A . D 4 HOH 138 639 138 HOH HOH A . D 4 HOH 139 640 139 HOH HOH A . D 4 HOH 140 641 140 HOH HOH A . D 4 HOH 141 642 141 HOH HOH A . D 4 HOH 142 643 142 HOH HOH A . D 4 HOH 143 644 143 HOH HOH A . D 4 HOH 144 645 144 HOH HOH A . D 4 HOH 145 646 145 HOH HOH A . D 4 HOH 146 647 146 HOH HOH A . D 4 HOH 147 648 147 HOH HOH A . #