data_1IYG # _entry.id 1IYG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IYG pdb_00001iyg 10.2210/pdb1iyg/pdb RCSB RCSB005406 ? ? WWPDB D_1000005406 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmk001005263.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IYG _pdbx_database_status.recvd_initial_deposition_date 2002-08-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohashi, W.' 1 'Hirota, H.' 2 'Yamazaki, T.' 3 'Koshiba, S.' 4 'Hamada, T.' 5 'Yoshida, M.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohashi, W.' 1 ? primary 'Hirota, H.' 2 ? primary 'Yamazaki, T.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Hamada, T.' 5 ? primary 'Yoshida, M.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein (2010003O14)' _entity.formula_weight 15126.050 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'FIS1P-LIKE AND CGI-135 HOMOLOGOUS DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RSGI RUH-001' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDY VFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDY VFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmk001005263.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 GLU n 1 10 ALA n 1 11 VAL n 1 12 LEU n 1 13 ASN n 1 14 GLU n 1 15 LEU n 1 16 VAL n 1 17 SER n 1 18 VAL n 1 19 GLU n 1 20 ASP n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 PHE n 1 25 GLU n 1 26 ARG n 1 27 LYS n 1 28 PHE n 1 29 GLN n 1 30 SER n 1 31 GLU n 1 32 GLN n 1 33 ALA n 1 34 ALA n 1 35 GLY n 1 36 SER n 1 37 VAL n 1 38 SER n 1 39 LYS n 1 40 SER n 1 41 THR n 1 42 GLN n 1 43 PHE n 1 44 GLU n 1 45 TYR n 1 46 ALA n 1 47 TRP n 1 48 CYS n 1 49 LEU n 1 50 VAL n 1 51 ARG n 1 52 SER n 1 53 LYS n 1 54 TYR n 1 55 ASN n 1 56 GLU n 1 57 ASP n 1 58 ILE n 1 59 ARG n 1 60 ARG n 1 61 GLY n 1 62 ILE n 1 63 VAL n 1 64 LEU n 1 65 LEU n 1 66 GLU n 1 67 GLU n 1 68 LEU n 1 69 LEU n 1 70 PRO n 1 71 LYS n 1 72 GLY n 1 73 SER n 1 74 LYS n 1 75 GLU n 1 76 GLU n 1 77 GLN n 1 78 ARG n 1 79 ASP n 1 80 TYR n 1 81 VAL n 1 82 PHE n 1 83 TYR n 1 84 LEU n 1 85 ALA n 1 86 VAL n 1 87 GLY n 1 88 ASN n 1 89 TYR n 1 90 ARG n 1 91 LEU n 1 92 LYS n 1 93 GLU n 1 94 TYR n 1 95 GLU n 1 96 LYS n 1 97 ALA n 1 98 LEU n 1 99 LYS n 1 100 TYR n 1 101 VAL n 1 102 ARG n 1 103 GLY n 1 104 LEU n 1 105 LEU n 1 106 GLN n 1 107 THR n 1 108 GLU n 1 109 PRO n 1 110 GLN n 1 111 ASN n 1 112 ASN n 1 113 GLN n 1 114 ALA n 1 115 LYS n 1 116 GLU n 1 117 LEU n 1 118 GLU n 1 119 ARG n 1 120 LEU n 1 121 ILE n 1 122 ASP n 1 123 LYS n 1 124 ALA n 1 125 MET n 1 126 LYS n 1 127 LYS n 1 128 SER n 1 129 GLY n 1 130 PRO n 1 131 SER n 1 132 SER n 1 133 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis system' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTC11_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDYVFYLAVG NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q9CQ92 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IYG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 127 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9CQ92 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 127 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1IYG GLY A 1 ? UNP Q9CQ92 ? ? 'cloning artifact' 1 1 1 1IYG SER A 2 ? UNP Q9CQ92 ? ? 'cloning artifact' 2 2 1 1IYG SER A 3 ? UNP Q9CQ92 ? ? 'cloning artifact' 3 3 1 1IYG GLY A 4 ? UNP Q9CQ92 ? ? 'cloning artifact' 4 4 1 1IYG SER A 5 ? UNP Q9CQ92 ? ? 'cloning artifact' 5 5 1 1IYG SER A 6 ? UNP Q9CQ92 ? ? 'cloning artifact' 6 6 1 1IYG GLY A 7 ? UNP Q9CQ92 ? ? 'cloning artifact' 7 7 1 1IYG SER A 128 ? UNP Q9CQ92 ? ? 'cloning artifact' 128 8 1 1IYG GLY A 129 ? UNP Q9CQ92 ? ? 'cloning artifact' 129 9 1 1IYG PRO A 130 ? UNP Q9CQ92 ? ? 'cloning artifact' 130 10 1 1IYG SER A 131 ? UNP Q9CQ92 ? ? 'cloning artifact' 131 11 1 1IYG SER A 132 ? UNP Q9CQ92 ? ? 'cloning artifact' 132 12 1 1IYG GLY A 133 ? UNP Q9CQ92 ? ? 'cloning artifact' 133 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.6mM RSGI RUH-001 U-15N,13C; 20mM phosphate buffer NA, 100mM NaCl, 1mM DTT U-2H; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1IYG _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1IYG _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 1IYG _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'The submitted conformer models are those with the lowest number of target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1IYG _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection bruker 1 NMRPipe 2.1 processing Delaglio 2 NMRView 5.0.4 'data analysis' Johnson 3 CYANA 1.0.6 'structure solution' Guentert 4 CYANA 1.0.6 refinement Guentert 5 # _exptl.entry_id 1IYG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1IYG _struct.title 'Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IYG _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;MOUSE cDNA, FIS1P, CGI-135, STRUCTURAL GENOMICS, Hypothetical protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 8 ? GLU A 14 ? MET A 8 GLU A 14 1 ? 7 HELX_P HELX_P2 2 SER A 17 ? GLY A 35 ? SER A 17 GLY A 35 1 ? 19 HELX_P HELX_P3 3 SER A 38 ? SER A 52 ? SER A 38 SER A 52 1 ? 15 HELX_P HELX_P4 4 TYR A 54 ? LEU A 69 ? TYR A 54 LEU A 69 1 ? 16 HELX_P HELX_P5 5 LYS A 74 ? LEU A 91 ? LYS A 74 LEU A 91 1 ? 18 HELX_P HELX_P6 6 GLU A 93 ? GLU A 108 ? GLU A 93 GLU A 108 1 ? 16 HELX_P HELX_P7 7 ASN A 111 ? SER A 128 ? ASN A 111 SER A 128 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1IYG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IYG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 GLY 133 133 133 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-02-14 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 62 ? ? H A GLU 66 ? ? 1.46 2 1 O A ALA 85 ? ? H A TYR 89 ? ? 1.48 3 1 O A LEU 98 ? ? H A ARG 102 ? ? 1.49 4 1 O A LEU 21 ? ? H A GLU 25 ? ? 1.51 5 1 OD1 A ASN 111 ? ? H A ALA 114 ? ? 1.52 6 1 O A VAL 18 ? ? H A LYS 22 ? ? 1.55 7 2 O A ILE 62 ? ? H A GLU 66 ? ? 1.39 8 2 O A LEU 98 ? ? H A ARG 102 ? ? 1.45 9 2 O A LYS 22 ? ? H A ARG 26 ? ? 1.50 10 2 O A ASN 88 ? ? H A GLU 93 ? ? 1.51 11 2 O A TYR 80 ? ? H A TYR 83 ? ? 1.54 12 2 O A ALA 97 ? ? H A VAL 101 ? ? 1.58 13 2 O A ALA 85 ? ? H A TYR 89 ? ? 1.59 14 2 O A TYR 83 ? ? H A GLY 87 ? ? 1.60 15 3 O A GLU 116 ? ? H A LEU 120 ? ? 1.54 16 3 O A LEU 98 ? ? H A ARG 102 ? ? 1.56 17 3 O A ALA 85 ? ? H A TYR 89 ? ? 1.57 18 3 O A LEU 64 ? ? H A GLU 67 ? ? 1.58 19 3 O A ALA 97 ? ? H A VAL 101 ? ? 1.58 20 4 O A LEU 98 ? ? H A ARG 102 ? ? 1.44 21 4 O A ILE 62 ? ? H A GLU 66 ? ? 1.46 22 4 O A TYR 94 ? ? H A LEU 98 ? ? 1.51 23 4 O A ALA 85 ? ? H A TYR 89 ? ? 1.51 24 4 O A SER 40 ? ? H A GLU 44 ? ? 1.54 25 4 O A ALA 97 ? ? H A VAL 101 ? ? 1.58 26 4 O A LYS 27 ? ? H A GLU 31 ? ? 1.59 27 4 O A LEU 21 ? ? H A GLU 25 ? ? 1.59 28 5 O A ALA 10 ? ? H A GLU 14 ? ? 1.51 29 5 O A ALA 85 ? ? H A TYR 89 ? ? 1.52 30 5 OD1 A ASN 23 ? ? HH22 A ARG 26 ? ? 1.53 31 5 O A LEU 21 ? ? H A GLU 25 ? ? 1.54 32 5 O A LEU 98 ? ? H A ARG 102 ? ? 1.57 33 5 O A TYR 80 ? ? H A LEU 84 ? ? 1.58 34 5 O A GLU 116 ? ? H A LEU 120 ? ? 1.59 35 5 O A ALA 97 ? ? H A VAL 101 ? ? 1.60 36 6 O A LEU 98 ? ? H A ARG 102 ? ? 1.45 37 6 O A LYS 39 ? ? H A PHE 43 ? ? 1.47 38 6 O A ARG 26 ? ? H A SER 30 ? ? 1.49 39 6 O A ALA 85 ? ? H A TYR 89 ? ? 1.50 40 6 O A LEU 21 ? ? H A GLU 25 ? ? 1.54 41 6 O A SER 17 ? ? H A LEU 21 ? ? 1.55 42 6 O A GLU 116 ? ? H A LEU 120 ? ? 1.56 43 7 O A ILE 62 ? ? H A GLU 66 ? ? 1.41 44 7 O A GLU 116 ? ? H A LEU 120 ? ? 1.50 45 7 O A ALA 85 ? ? H A TYR 89 ? ? 1.50 46 7 O A TYR 94 ? ? H A LEU 98 ? ? 1.51 47 7 O A ALA 10 ? ? H A GLU 14 ? ? 1.53 48 7 O A LEU 98 ? ? H A ARG 102 ? ? 1.53 49 7 O A LEU 64 ? ? H A GLU 67 ? ? 1.58 50 7 O A ALA 97 ? ? H A VAL 101 ? ? 1.59 51 8 OE1 A GLU 31 ? ? HG A SER 38 ? ? 1.42 52 8 O A ILE 62 ? ? H A GLU 66 ? ? 1.48 53 8 O A LEU 98 ? ? H A ARG 102 ? ? 1.50 54 8 O A ALA 85 ? ? H A TYR 89 ? ? 1.50 55 8 O A LEU 21 ? ? H A GLU 25 ? ? 1.51 56 8 O A SER 17 ? ? H A LEU 21 ? ? 1.52 57 8 O A ALA 97 ? ? H A VAL 101 ? ? 1.53 58 8 O A TYR 89 ? ? H A LYS 92 ? ? 1.55 59 8 O A LEU 64 ? ? H A GLU 67 ? ? 1.56 60 8 O A PHE 43 ? ? H A TRP 47 ? ? 1.56 61 8 O A LYS 27 ? ? H A GLU 31 ? ? 1.57 62 9 O A ILE 62 ? ? H A GLU 66 ? ? 1.38 63 9 O A LEU 21 ? ? H A GLU 25 ? ? 1.50 64 9 O A LEU 104 ? ? H A THR 107 ? ? 1.52 65 9 O A VAL 18 ? ? H A LYS 22 ? ? 1.55 66 9 O A LEU 98 ? ? H A ARG 102 ? ? 1.56 67 9 O A ASN 111 ? ? H A ALA 114 ? ? 1.56 68 9 O A TYR 94 ? ? H A LEU 98 ? ? 1.56 69 9 O A TYR 89 ? ? H A LYS 92 ? ? 1.59 70 9 O A ARG 59 ? ? H A ILE 62 ? ? 1.59 71 9 O A LEU 49 ? ? H A ARG 51 ? ? 1.59 72 9 O A ALA 97 ? ? H A VAL 101 ? ? 1.60 73 10 O A ILE 62 ? ? H A GLU 66 ? ? 1.46 74 10 O A ALA 10 ? ? H A GLU 14 ? ? 1.54 75 10 O A ARG 26 ? ? H A SER 30 ? ? 1.56 76 10 O A GLU 116 ? ? H A LEU 120 ? ? 1.58 77 10 O A ALA 85 ? ? H A TYR 89 ? ? 1.59 78 11 O A ILE 62 ? ? H A GLU 66 ? ? 1.39 79 11 O A LEU 98 ? ? H A ARG 102 ? ? 1.49 80 11 O A GLY 7 ? ? H A VAL 11 ? ? 1.49 81 11 O A ASP 20 ? ? H A PHE 24 ? ? 1.51 82 11 O A MET 8 ? ? H A LEU 12 ? ? 1.54 83 11 O A LEU 64 ? ? H A LEU 68 ? ? 1.55 84 11 O A LYS 39 ? ? H A PHE 43 ? ? 1.56 85 11 O A TYR 89 ? ? H A LYS 92 ? ? 1.58 86 11 O A SER 40 ? ? H A GLU 44 ? ? 1.58 87 12 O A LEU 21 ? ? H A GLU 25 ? ? 1.51 88 12 O A VAL 18 ? ? H A LYS 22 ? ? 1.52 89 12 O A LEU 98 ? ? H A ARG 102 ? ? 1.54 90 12 O A LEU 49 ? ? H A ARG 51 ? ? 1.58 91 12 O A ILE 62 ? ? H A GLU 66 ? ? 1.58 92 12 O A TYR 80 ? ? H A TYR 83 ? ? 1.59 93 12 O A LEU 64 ? ? H A GLU 67 ? ? 1.59 94 12 O A ALA 97 ? ? H A VAL 101 ? ? 1.59 95 12 O A GLU 116 ? ? H A LEU 120 ? ? 1.59 96 13 O A ILE 62 ? ? H A GLU 66 ? ? 1.46 97 13 O A ALA 85 ? ? H A TYR 89 ? ? 1.50 98 13 O A LEU 98 ? ? H A ARG 102 ? ? 1.51 99 13 O A GLU 93 ? ? H A ALA 97 ? ? 1.52 100 13 O A LEU 98 ? ? H A VAL 101 ? ? 1.54 101 13 O A TYR 89 ? ? H A LYS 92 ? ? 1.54 102 13 O A LEU 49 ? ? H A ARG 51 ? ? 1.55 103 13 O A TYR 80 ? ? H A LEU 84 ? ? 1.56 104 13 O A GLU 116 ? ? H A LEU 120 ? ? 1.57 105 14 O A ILE 62 ? ? H A GLU 66 ? ? 1.46 106 14 O A LEU 21 ? ? H A GLU 25 ? ? 1.51 107 14 O A LEU 98 ? ? H A ARG 102 ? ? 1.53 108 14 O A GLU 116 ? ? H A LEU 120 ? ? 1.54 109 14 O A ALA 97 ? ? H A VAL 101 ? ? 1.55 110 14 O A ALA 85 ? ? H A TYR 89 ? ? 1.56 111 14 O A LEU 49 ? ? H A SER 52 ? ? 1.59 112 14 O A TYR 89 ? ? H A LYS 92 ? ? 1.59 113 15 O A LEU 98 ? ? H A ARG 102 ? ? 1.47 114 15 O A ILE 62 ? ? H A GLU 66 ? ? 1.47 115 15 O A VAL 101 ? ? H A LEU 105 ? ? 1.49 116 15 O A ASN 112 ? ? H A GLU 116 ? ? 1.50 117 15 O A LEU 104 ? ? H A THR 107 ? ? 1.55 118 15 O A LEU 84 ? ? HD21 A ASN 88 ? ? 1.55 119 15 O A LEU 49 ? ? H A ARG 51 ? ? 1.56 120 15 O A GLU 116 ? ? H A LEU 120 ? ? 1.59 121 16 O A ILE 62 ? ? H A GLU 66 ? ? 1.43 122 16 O A ALA 85 ? ? H A TYR 89 ? ? 1.50 123 16 O A LEU 98 ? ? H A ARG 102 ? ? 1.55 124 16 O A LEU 49 ? ? H A ARG 51 ? ? 1.57 125 16 O A TYR 80 ? ? H A TYR 83 ? ? 1.57 126 16 O A LEU 64 ? ? H A GLU 67 ? ? 1.58 127 16 O A ALA 97 ? ? H A VAL 101 ? ? 1.58 128 17 O A ILE 62 ? ? H A GLU 66 ? ? 1.44 129 17 O A LEU 98 ? ? H A ARG 102 ? ? 1.50 130 17 O A LEU 21 ? ? H A GLU 25 ? ? 1.52 131 17 O A GLU 116 ? ? H A LEU 120 ? ? 1.59 132 17 O A VAL 18 ? ? H A LYS 22 ? ? 1.60 133 18 O A GLY 61 ? ? H A LEU 65 ? ? 1.48 134 18 O A LYS 22 ? ? H A ARG 26 ? ? 1.48 135 18 O A TYR 83 ? ? H A GLY 87 ? ? 1.49 136 18 O A LEU 84 ? ? HD21 A ASN 88 ? ? 1.50 137 18 O A ASP 20 ? ? H A PHE 24 ? ? 1.51 138 18 O A ILE 62 ? ? H A GLU 66 ? ? 1.52 139 18 O A LEU 98 ? ? H A ARG 102 ? ? 1.53 140 18 O A LYS 39 ? ? H A PHE 43 ? ? 1.54 141 18 O A SER 40 ? ? H A GLU 44 ? ? 1.55 142 18 O A ARG 26 ? ? H A SER 30 ? ? 1.58 143 18 O A ALA 97 ? ? H A VAL 101 ? ? 1.58 144 18 O A LYS 123 ? ? H A LYS 127 ? ? 1.58 145 18 O A TYR 94 ? ? H A LEU 98 ? ? 1.58 146 18 O A GLU 116 ? ? H A LEU 120 ? ? 1.59 147 18 O A LEU 64 ? ? H A GLU 67 ? ? 1.59 148 19 O A ILE 62 ? ? H A GLU 66 ? ? 1.40 149 19 O A LEU 98 ? ? H A ARG 102 ? ? 1.45 150 19 O A LEU 21 ? ? H A GLU 25 ? ? 1.48 151 19 O A LEU 84 ? ? HD21 A ASN 88 ? ? 1.54 152 19 O A ALA 85 ? ? H A TYR 89 ? ? 1.54 153 19 O A VAL 18 ? ? H A LYS 22 ? ? 1.54 154 19 O A TYR 94 ? ? H A LEU 98 ? ? 1.56 155 19 O A GLU 116 ? ? H A LEU 120 ? ? 1.59 156 19 O A GLY 61 ? ? H A LEU 65 ? ? 1.59 157 19 O A TYR 89 ? ? H A LYS 92 ? ? 1.60 158 20 O A ILE 62 ? ? H A GLU 66 ? ? 1.44 159 20 O A TYR 94 ? ? H A LEU 98 ? ? 1.48 160 20 O A LYS 39 ? ? H A PHE 43 ? ? 1.49 161 20 O A LEU 21 ? ? H A GLU 25 ? ? 1.50 162 20 O A GLU 116 ? ? H A LEU 120 ? ? 1.52 163 20 O A ASN 111 ? ? H A GLN 113 ? ? 1.53 164 20 O A ARG 26 ? ? H A SER 30 ? ? 1.58 165 20 O A ALA 10 ? ? H A GLU 14 ? ? 1.58 166 20 O A ALA 85 ? ? H A TYR 89 ? ? 1.58 167 20 O A TYR 89 ? ? H A LYS 92 ? ? 1.59 168 20 O A ALA 97 ? ? H A VAL 101 ? ? 1.59 169 20 O A GLU 19 ? ? H A ASN 23 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 59.83 90.37 2 1 SER A 3 ? ? 63.35 119.19 3 1 SER A 36 ? ? 171.61 130.66 4 1 SER A 40 ? ? -45.28 -70.31 5 1 GLU A 44 ? ? -59.00 -75.05 6 1 SER A 52 ? ? -38.42 157.53 7 1 SER A 73 ? ? -89.62 -75.31 8 1 LYS A 74 ? ? -150.05 -82.27 9 1 TYR A 80 ? ? -82.27 -72.15 10 1 LYS A 99 ? ? -39.60 -29.53 11 1 SER A 131 ? ? 72.59 157.72 12 2 SER A 6 ? ? 66.64 159.69 13 2 MET A 8 ? ? -124.24 -58.95 14 2 SER A 36 ? ? -179.41 131.36 15 2 GLU A 44 ? ? -61.32 -79.43 16 2 SER A 52 ? ? -39.52 158.81 17 2 SER A 73 ? ? 172.02 168.86 18 2 LYS A 74 ? ? -52.88 -94.78 19 2 GLU A 75 ? ? -38.74 -29.87 20 2 TYR A 80 ? ? -63.03 -77.30 21 2 LEU A 84 ? ? -38.93 -39.83 22 2 GLU A 93 ? ? -99.85 49.50 23 2 LYS A 99 ? ? -39.80 -29.85 24 2 ALA A 124 ? ? -61.79 -164.16 25 2 MET A 125 ? ? 74.81 -45.52 26 2 LYS A 127 ? ? -94.95 51.84 27 2 SER A 128 ? ? -145.27 -47.51 28 2 SER A 131 ? ? -40.37 160.09 29 2 SER A 132 ? ? -167.28 109.15 30 3 SER A 2 ? ? -155.30 77.12 31 3 ASN A 13 ? ? -56.74 -79.46 32 3 LEU A 15 ? ? -109.24 -146.78 33 3 SER A 36 ? ? 179.93 132.48 34 3 GLU A 44 ? ? -68.19 -78.09 35 3 SER A 52 ? ? -46.95 174.03 36 3 LYS A 74 ? ? 176.13 -56.74 37 3 TYR A 80 ? ? -83.52 -72.10 38 3 GLU A 95 ? ? -44.16 -75.89 39 3 ALA A 97 ? ? -50.61 -71.77 40 3 LYS A 99 ? ? -36.83 -35.00 41 3 LYS A 115 ? ? -45.48 -73.48 42 4 SER A 2 ? ? 55.24 83.92 43 4 ASP A 20 ? ? -91.86 -62.61 44 4 SER A 36 ? ? 174.34 124.29 45 4 GLU A 44 ? ? -62.72 -74.14 46 4 SER A 52 ? ? -39.24 158.72 47 4 LYS A 71 ? ? -93.44 44.51 48 4 SER A 73 ? ? -68.95 -172.06 49 4 TYR A 80 ? ? -72.79 -72.01 50 4 PHE A 82 ? ? -39.72 -39.37 51 4 LEU A 84 ? ? -39.71 -38.11 52 4 LYS A 99 ? ? -39.27 -30.23 53 4 LYS A 126 ? ? -105.62 59.26 54 4 SER A 131 ? ? -178.01 -54.93 55 4 SER A 132 ? ? 64.71 130.33 56 5 MET A 8 ? ? -126.65 -58.81 57 5 GLU A 14 ? ? -38.87 156.97 58 5 SER A 30 ? ? -45.86 -74.42 59 5 SER A 36 ? ? 168.62 129.06 60 5 SER A 40 ? ? -55.92 -71.08 61 5 SER A 52 ? ? -38.82 158.83 62 5 LYS A 71 ? ? -99.21 51.51 63 5 SER A 73 ? ? -64.57 -163.00 64 5 LYS A 92 ? ? 54.00 19.97 65 5 GLU A 93 ? ? -85.49 45.21 66 5 ALA A 97 ? ? -46.75 -74.48 67 5 LYS A 99 ? ? -38.27 -36.33 68 5 GLU A 108 ? ? -152.54 64.72 69 5 LEU A 120 ? ? -59.25 -71.80 70 5 LYS A 127 ? ? -121.35 -50.53 71 6 SER A 2 ? ? 48.82 96.83 72 6 MET A 8 ? ? -128.06 -55.70 73 6 ASN A 13 ? ? -60.37 -76.52 74 6 VAL A 16 ? ? -55.96 -179.28 75 6 PHE A 24 ? ? -93.48 -61.29 76 6 SER A 36 ? ? 165.90 140.90 77 6 SER A 40 ? ? -36.20 -84.76 78 6 SER A 52 ? ? -41.84 163.38 79 6 SER A 73 ? ? -69.34 -176.32 80 6 LEU A 84 ? ? -39.14 -38.70 81 6 GLU A 95 ? ? -44.54 -75.28 82 6 ALA A 97 ? ? -46.31 -72.34 83 6 SER A 128 ? ? 56.59 91.82 84 6 SER A 131 ? ? -173.92 85.03 85 7 SER A 3 ? ? -164.45 110.92 86 7 SER A 6 ? ? -158.81 -63.62 87 7 GLN A 29 ? ? -54.32 -70.23 88 7 SER A 36 ? ? 168.70 129.77 89 7 GLN A 42 ? ? -57.76 -72.72 90 7 GLU A 44 ? ? -59.45 -76.70 91 7 SER A 52 ? ? -44.03 167.01 92 7 SER A 73 ? ? -147.48 -65.37 93 7 LYS A 74 ? ? -164.98 -76.43 94 7 LYS A 92 ? ? 54.78 18.03 95 7 GLU A 93 ? ? -84.06 45.80 96 7 GLU A 95 ? ? -37.75 -72.82 97 7 LYS A 99 ? ? -39.32 -29.76 98 7 SER A 132 ? ? 73.06 -67.91 99 8 SER A 2 ? ? 56.45 165.39 100 8 ARG A 26 ? ? -46.34 -70.83 101 8 SER A 36 ? ? 177.29 127.36 102 8 LYS A 39 ? ? -44.73 -70.07 103 8 GLU A 44 ? ? -37.35 -79.73 104 8 SER A 52 ? ? -43.73 166.75 105 8 LYS A 71 ? ? -91.25 35.35 106 8 TYR A 80 ? ? -80.28 -72.74 107 8 GLU A 93 ? ? -105.51 72.54 108 8 LYS A 99 ? ? -38.89 -30.80 109 8 ASN A 111 ? ? -50.95 98.42 110 8 LYS A 126 ? ? -87.05 47.44 111 8 LYS A 127 ? ? -141.87 -61.70 112 8 SER A 128 ? ? 59.38 -174.00 113 9 GLU A 14 ? ? -38.03 145.25 114 9 SER A 36 ? ? 178.09 129.96 115 9 GLU A 44 ? ? -61.79 -76.61 116 9 VAL A 50 ? ? -69.06 59.76 117 9 ARG A 51 ? ? -175.35 -39.95 118 9 SER A 52 ? ? -39.16 153.78 119 9 VAL A 63 ? ? -28.78 -63.12 120 9 SER A 73 ? ? -96.04 -73.10 121 9 LYS A 74 ? ? -166.62 -69.11 122 9 TYR A 80 ? ? -81.77 -70.49 123 9 GLU A 93 ? ? -108.93 76.76 124 9 SER A 131 ? ? -174.63 147.73 125 10 SER A 2 ? ? -170.63 132.32 126 10 SER A 3 ? ? -176.00 -55.45 127 10 SER A 5 ? ? -69.41 94.38 128 10 SER A 6 ? ? 63.42 68.84 129 10 GLU A 14 ? ? -45.15 158.97 130 10 SER A 36 ? ? 174.26 142.54 131 10 SER A 52 ? ? -56.79 174.80 132 10 ARG A 59 ? ? -38.51 -34.04 133 10 SER A 73 ? ? -100.28 -89.78 134 10 LYS A 74 ? ? -160.67 -66.67 135 10 GLU A 93 ? ? -88.12 42.35 136 10 GLU A 95 ? ? -41.36 -73.82 137 10 LYS A 99 ? ? -39.11 -29.84 138 10 ALA A 124 ? ? -40.21 -82.51 139 11 SER A 5 ? ? -158.43 -70.51 140 11 ASN A 13 ? ? -81.92 -71.41 141 11 GLU A 14 ? ? -38.89 123.51 142 11 SER A 36 ? ? 170.92 122.18 143 11 SER A 40 ? ? -56.77 -81.69 144 11 SER A 52 ? ? -51.20 -177.74 145 11 SER A 73 ? ? -83.33 -157.40 146 11 GLU A 95 ? ? -53.90 -77.99 147 11 ALA A 97 ? ? -54.30 -75.99 148 11 LYS A 99 ? ? -39.05 -35.51 149 11 LYS A 127 ? ? -55.71 -74.37 150 11 SER A 128 ? ? 44.29 86.37 151 11 SER A 131 ? ? -144.55 -64.44 152 11 SER A 132 ? ? -147.38 -59.72 153 12 SER A 5 ? ? -127.98 -63.15 154 12 ASN A 13 ? ? -89.51 -79.20 155 12 GLN A 29 ? ? -42.55 -72.53 156 12 SER A 36 ? ? 163.38 131.27 157 12 GLU A 44 ? ? -60.47 -78.07 158 12 VAL A 50 ? ? -68.63 60.14 159 12 ARG A 51 ? ? -173.00 -39.06 160 12 SER A 52 ? ? -39.39 159.42 161 12 SER A 73 ? ? -121.16 -55.36 162 12 LYS A 74 ? ? 177.94 -72.41 163 12 TYR A 80 ? ? -74.07 -77.85 164 12 PHE A 82 ? ? -39.42 -38.38 165 12 GLU A 93 ? ? -88.80 47.93 166 12 GLU A 95 ? ? -38.75 -73.91 167 12 ALA A 97 ? ? -38.51 -70.73 168 12 LYS A 99 ? ? -39.02 -32.93 169 12 SER A 131 ? ? 64.51 175.42 170 12 SER A 132 ? ? 171.30 -54.18 171 13 SER A 6 ? ? 78.52 -61.28 172 13 ASN A 13 ? ? -63.58 -82.99 173 13 ASN A 23 ? ? -39.30 -33.81 174 13 SER A 36 ? ? 176.36 126.69 175 13 GLU A 44 ? ? -50.78 -70.55 176 13 VAL A 50 ? ? -67.93 59.36 177 13 ARG A 51 ? ? 179.79 -35.53 178 13 SER A 52 ? ? -39.72 152.49 179 13 LYS A 71 ? ? -94.43 42.72 180 13 SER A 73 ? ? -75.60 -151.61 181 13 LYS A 74 ? ? -76.20 -81.23 182 13 TYR A 80 ? ? -88.39 -73.08 183 13 LYS A 92 ? ? 70.59 30.40 184 13 GLU A 95 ? ? -38.11 -30.54 185 13 SER A 132 ? ? 47.85 80.96 186 14 SER A 6 ? ? 55.42 177.82 187 14 ASN A 13 ? ? -62.52 -81.05 188 14 GLU A 14 ? ? -40.30 158.05 189 14 SER A 36 ? ? 173.13 126.11 190 14 GLU A 44 ? ? -64.25 -72.88 191 14 SER A 52 ? ? -62.01 -170.97 192 14 ILE A 58 ? ? -57.24 -70.98 193 14 ARG A 59 ? ? -37.64 -34.26 194 14 SER A 73 ? ? -158.25 -89.61 195 14 LYS A 74 ? ? -142.01 -72.91 196 14 TYR A 80 ? ? -77.70 -71.44 197 14 GLU A 95 ? ? -36.91 -72.14 198 14 LYS A 99 ? ? -36.84 -33.25 199 14 LYS A 126 ? ? -88.02 44.86 200 14 LYS A 127 ? ? -136.53 -62.95 201 14 SER A 128 ? ? 48.26 82.92 202 14 SER A 132 ? ? -169.32 -57.40 203 15 SER A 2 ? ? -150.97 -47.78 204 15 SER A 3 ? ? 63.55 -78.10 205 15 SER A 6 ? ? 58.81 160.35 206 15 MET A 8 ? ? -132.07 -58.08 207 15 ASN A 13 ? ? -60.13 -83.57 208 15 GLU A 14 ? ? -42.75 152.16 209 15 SER A 36 ? ? 174.92 129.31 210 15 GLU A 44 ? ? -56.07 -70.42 211 15 VAL A 50 ? ? -69.19 57.12 212 15 ARG A 51 ? ? -171.27 -38.71 213 15 SER A 52 ? ? -35.25 144.04 214 15 ARG A 59 ? ? -34.26 -70.40 215 15 LYS A 92 ? ? 53.93 16.87 216 15 LYS A 99 ? ? -37.29 -31.43 217 15 LYS A 127 ? ? -66.04 83.20 218 15 SER A 128 ? ? 177.30 150.99 219 16 SER A 3 ? ? -172.35 133.74 220 16 SER A 6 ? ? -39.68 116.06 221 16 MET A 8 ? ? -124.34 -57.56 222 16 SER A 36 ? ? -179.16 126.32 223 16 GLU A 44 ? ? -64.28 -81.08 224 16 VAL A 50 ? ? -68.75 59.00 225 16 ARG A 51 ? ? -177.36 -37.19 226 16 SER A 52 ? ? -39.80 159.59 227 16 LYS A 71 ? ? -103.76 51.38 228 16 SER A 73 ? ? -74.05 -169.77 229 16 TYR A 80 ? ? -69.63 -76.24 230 16 GLU A 95 ? ? -42.27 -72.87 231 16 LYS A 99 ? ? -37.82 -32.95 232 16 LYS A 127 ? ? -145.46 -56.18 233 17 SER A 5 ? ? 173.23 174.46 234 17 ASN A 13 ? ? -90.15 -76.23 235 17 SER A 36 ? ? 171.85 135.83 236 17 GLU A 44 ? ? -64.02 -82.31 237 17 ARG A 51 ? ? -172.66 -39.53 238 17 SER A 52 ? ? -42.08 160.93 239 17 ILE A 62 ? ? -94.86 -68.30 240 17 VAL A 63 ? ? -28.61 -63.10 241 17 LYS A 74 ? ? -178.92 -69.16 242 17 TYR A 80 ? ? -83.98 -74.04 243 17 GLU A 93 ? ? -85.35 45.88 244 17 GLU A 95 ? ? -38.72 -73.07 245 17 ALA A 97 ? ? -38.91 -71.41 246 17 LYS A 99 ? ? -37.56 -32.46 247 17 LYS A 126 ? ? -89.65 46.36 248 17 SER A 132 ? ? -132.36 -58.44 249 18 SER A 2 ? ? 61.08 81.66 250 18 SER A 5 ? ? -142.70 -70.18 251 18 SER A 36 ? ? 170.63 140.73 252 18 GLU A 44 ? ? -44.28 -80.07 253 18 LEU A 49 ? ? -39.13 -71.65 254 18 SER A 52 ? ? -49.20 178.49 255 18 LYS A 71 ? ? -90.76 39.70 256 18 LYS A 74 ? ? -178.29 -63.05 257 18 GLU A 95 ? ? -49.62 -72.86 258 18 LYS A 99 ? ? -37.06 -37.47 259 18 GLU A 108 ? ? -151.25 64.57 260 18 SER A 132 ? ? 65.11 170.56 261 19 SER A 6 ? ? 175.53 129.37 262 19 ASN A 13 ? ? -92.59 -80.28 263 19 GLU A 14 ? ? -45.01 160.60 264 19 ASP A 20 ? ? -90.36 -63.06 265 19 GLU A 44 ? ? -61.52 -72.89 266 19 SER A 52 ? ? -66.66 -166.48 267 19 VAL A 63 ? ? -35.75 -36.08 268 19 TYR A 80 ? ? -77.67 -70.92 269 19 GLU A 93 ? ? -83.23 49.48 270 19 GLU A 95 ? ? -38.57 -75.21 271 19 LYS A 99 ? ? -39.89 -29.59 272 19 ASN A 111 ? ? -55.74 107.75 273 19 SER A 128 ? ? 55.92 99.06 274 19 SER A 132 ? ? -158.82 85.58 275 20 SER A 3 ? ? 178.52 107.23 276 20 SER A 36 ? ? 178.28 142.83 277 20 SER A 40 ? ? -41.41 -76.34 278 20 GLU A 44 ? ? -58.45 -70.50 279 20 SER A 52 ? ? -38.80 157.38 280 20 SER A 73 ? ? -89.09 -81.00 281 20 LYS A 74 ? ? -156.67 -62.69 282 20 GLN A 106 ? ? -46.95 -81.91 283 20 ASN A 112 ? ? 65.43 -62.33 284 20 LYS A 127 ? ? -101.53 69.13 285 20 SER A 128 ? ? 60.38 91.42 #