data_1IZ3 # _entry.id 1IZ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IZ3 pdb_00001iz3 10.2210/pdb1iz3/pdb RCSB RCSB005427 ? ? WWPDB D_1000005427 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-06-10 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IZ3 _pdbx_database_status.recvd_initial_deposition_date 2002-09-19 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, C.' 1 'Kim, S.-J.' 2 'Jeong, D.-G.' 3 'Lee, S.M.' 4 'Ryu, S.-E.' 5 # _citation.id primary _citation.title 'Structure of human FIH-1 reveals a unique active site pocket and interaction sites for HIF-1 and von Hippel-Lindau.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 7558 _citation.page_last 7563 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12482756 _citation.pdbx_database_id_DOI 10.1074/jbc.M210385200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, C.' 1 ? primary 'Kim, S.J.' 2 ? primary 'Jeong, D.G.' 3 ? primary 'Lee, S.M.' 4 ? primary 'Ryu, S.E.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man FIH 40633.320 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'factor inhibiting HIF1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MAATAAEAVTSGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEY LQENIGNGDFSVYSASTHKFLYYDEKK(MSE)ANFQNFKPRSNREE(MSE)KFHEFVEKLQDIQQRGGEERLYLQQTLND TVGGKIV(MSE)DFLGFNWNWINKQQGKRGWGQLTSNLLLIG(MSE)EGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQF ECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIP(MSE)YWWHHIESLLNGGITITVNFWYKGA PTPKRIEYPLKAHQKVAI(MSE)RNIEK(MSE)LGEALGNPQEVGPLLNT(MSE)IKGRYN ; _entity_poly.pdbx_seq_one_letter_code_can ;MAATAAEAVTSGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEY LQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGGKIVM DFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMR NIEKMLGEALGNPQEVGPLLNTMIKGRYN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'SULFATE ION' _pdbx_entity_nonpoly.comp_id SO4 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 THR n 1 5 ALA n 1 6 ALA n 1 7 GLU n 1 8 ALA n 1 9 VAL n 1 10 THR n 1 11 SER n 1 12 GLY n 1 13 SER n 1 14 GLY n 1 15 GLU n 1 16 PRO n 1 17 ARG n 1 18 GLU n 1 19 GLU n 1 20 ALA n 1 21 GLY n 1 22 ALA n 1 23 LEU n 1 24 GLY n 1 25 PRO n 1 26 ALA n 1 27 TRP n 1 28 ASP n 1 29 GLU n 1 30 SER n 1 31 GLN n 1 32 LEU n 1 33 ARG n 1 34 SER n 1 35 TYR n 1 36 SER n 1 37 PHE n 1 38 PRO n 1 39 THR n 1 40 ARG n 1 41 PRO n 1 42 ILE n 1 43 PRO n 1 44 ARG n 1 45 LEU n 1 46 SER n 1 47 GLN n 1 48 SER n 1 49 ASP n 1 50 PRO n 1 51 ARG n 1 52 ALA n 1 53 GLU n 1 54 GLU n 1 55 LEU n 1 56 ILE n 1 57 GLU n 1 58 ASN n 1 59 GLU n 1 60 GLU n 1 61 PRO n 1 62 VAL n 1 63 VAL n 1 64 LEU n 1 65 THR n 1 66 ASP n 1 67 THR n 1 68 ASN n 1 69 LEU n 1 70 VAL n 1 71 TYR n 1 72 PRO n 1 73 ALA n 1 74 LEU n 1 75 LYS n 1 76 TRP n 1 77 ASP n 1 78 LEU n 1 79 GLU n 1 80 TYR n 1 81 LEU n 1 82 GLN n 1 83 GLU n 1 84 ASN n 1 85 ILE n 1 86 GLY n 1 87 ASN n 1 88 GLY n 1 89 ASP n 1 90 PHE n 1 91 SER n 1 92 VAL n 1 93 TYR n 1 94 SER n 1 95 ALA n 1 96 SER n 1 97 THR n 1 98 HIS n 1 99 LYS n 1 100 PHE n 1 101 LEU n 1 102 TYR n 1 103 TYR n 1 104 ASP n 1 105 GLU n 1 106 LYS n 1 107 LYS n 1 108 MSE n 1 109 ALA n 1 110 ASN n 1 111 PHE n 1 112 GLN n 1 113 ASN n 1 114 PHE n 1 115 LYS n 1 116 PRO n 1 117 ARG n 1 118 SER n 1 119 ASN n 1 120 ARG n 1 121 GLU n 1 122 GLU n 1 123 MSE n 1 124 LYS n 1 125 PHE n 1 126 HIS n 1 127 GLU n 1 128 PHE n 1 129 VAL n 1 130 GLU n 1 131 LYS n 1 132 LEU n 1 133 GLN n 1 134 ASP n 1 135 ILE n 1 136 GLN n 1 137 GLN n 1 138 ARG n 1 139 GLY n 1 140 GLY n 1 141 GLU n 1 142 GLU n 1 143 ARG n 1 144 LEU n 1 145 TYR n 1 146 LEU n 1 147 GLN n 1 148 GLN n 1 149 THR n 1 150 LEU n 1 151 ASN n 1 152 ASP n 1 153 THR n 1 154 VAL n 1 155 GLY n 1 156 GLY n 1 157 LYS n 1 158 ILE n 1 159 VAL n 1 160 MSE n 1 161 ASP n 1 162 PHE n 1 163 LEU n 1 164 GLY n 1 165 PHE n 1 166 ASN n 1 167 TRP n 1 168 ASN n 1 169 TRP n 1 170 ILE n 1 171 ASN n 1 172 LYS n 1 173 GLN n 1 174 GLN n 1 175 GLY n 1 176 LYS n 1 177 ARG n 1 178 GLY n 1 179 TRP n 1 180 GLY n 1 181 GLN n 1 182 LEU n 1 183 THR n 1 184 SER n 1 185 ASN n 1 186 LEU n 1 187 LEU n 1 188 LEU n 1 189 ILE n 1 190 GLY n 1 191 MSE n 1 192 GLU n 1 193 GLY n 1 194 ASN n 1 195 VAL n 1 196 THR n 1 197 PRO n 1 198 ALA n 1 199 HIS n 1 200 TYR n 1 201 ASP n 1 202 GLU n 1 203 GLN n 1 204 GLN n 1 205 ASN n 1 206 PHE n 1 207 PHE n 1 208 ALA n 1 209 GLN n 1 210 ILE n 1 211 LYS n 1 212 GLY n 1 213 TYR n 1 214 LYS n 1 215 ARG n 1 216 CYS n 1 217 ILE n 1 218 LEU n 1 219 PHE n 1 220 PRO n 1 221 PRO n 1 222 ASP n 1 223 GLN n 1 224 PHE n 1 225 GLU n 1 226 CYS n 1 227 LEU n 1 228 TYR n 1 229 PRO n 1 230 TYR n 1 231 PRO n 1 232 VAL n 1 233 HIS n 1 234 HIS n 1 235 PRO n 1 236 CYS n 1 237 ASP n 1 238 ARG n 1 239 GLN n 1 240 SER n 1 241 GLN n 1 242 VAL n 1 243 ASP n 1 244 PHE n 1 245 ASP n 1 246 ASN n 1 247 PRO n 1 248 ASP n 1 249 TYR n 1 250 GLU n 1 251 ARG n 1 252 PHE n 1 253 PRO n 1 254 ASN n 1 255 PHE n 1 256 GLN n 1 257 ASN n 1 258 VAL n 1 259 VAL n 1 260 GLY n 1 261 TYR n 1 262 GLU n 1 263 THR n 1 264 VAL n 1 265 VAL n 1 266 GLY n 1 267 PRO n 1 268 GLY n 1 269 ASP n 1 270 VAL n 1 271 LEU n 1 272 TYR n 1 273 ILE n 1 274 PRO n 1 275 MSE n 1 276 TYR n 1 277 TRP n 1 278 TRP n 1 279 HIS n 1 280 HIS n 1 281 ILE n 1 282 GLU n 1 283 SER n 1 284 LEU n 1 285 LEU n 1 286 ASN n 1 287 GLY n 1 288 GLY n 1 289 ILE n 1 290 THR n 1 291 ILE n 1 292 THR n 1 293 VAL n 1 294 ASN n 1 295 PHE n 1 296 TRP n 1 297 TYR n 1 298 LYS n 1 299 GLY n 1 300 ALA n 1 301 PRO n 1 302 THR n 1 303 PRO n 1 304 LYS n 1 305 ARG n 1 306 ILE n 1 307 GLU n 1 308 TYR n 1 309 PRO n 1 310 LEU n 1 311 LYS n 1 312 ALA n 1 313 HIS n 1 314 GLN n 1 315 LYS n 1 316 VAL n 1 317 ALA n 1 318 ILE n 1 319 MSE n 1 320 ARG n 1 321 ASN n 1 322 ILE n 1 323 GLU n 1 324 LYS n 1 325 MSE n 1 326 LEU n 1 327 GLY n 1 328 GLU n 1 329 ALA n 1 330 LEU n 1 331 GLY n 1 332 ASN n 1 333 PRO n 1 334 GLN n 1 335 GLU n 1 336 VAL n 1 337 GLY n 1 338 PRO n 1 339 LEU n 1 340 LEU n 1 341 ASN n 1 342 THR n 1 343 MSE n 1 344 ILE n 1 345 LYS n 1 346 GLY n 1 347 ARG n 1 348 TYR n 1 349 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 THR 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 MSE 108 108 108 MSE MSE A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 MSE 123 123 123 MSE MSE A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 MSE 160 160 160 MSE MSE A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 TRP 167 167 167 TRP TRP A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 TRP 169 169 169 TRP TRP A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 MSE 191 191 191 MSE MSE A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 GLN 204 204 204 GLN GLN A . n A 1 205 ASN 205 205 205 ASN ASN A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 PHE 207 207 207 PHE PHE A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 TYR 213 213 213 TYR TYR A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 CYS 216 216 216 CYS CYS A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 ASP 222 222 222 ASP ASP A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 CYS 226 226 226 CYS CYS A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 TYR 228 228 228 TYR TYR A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 PRO 231 231 231 PRO PRO A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 HIS 233 233 233 HIS HIS A . n A 1 234 HIS 234 234 234 HIS HIS A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 CYS 236 236 236 CYS CYS A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 GLN 239 239 239 GLN GLN A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 PHE 244 244 244 PHE PHE A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 ASN 246 246 246 ASN ASN A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 ASP 248 248 248 ASP ASP A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 PHE 252 252 252 PHE PHE A . n A 1 253 PRO 253 253 253 PRO PRO A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 GLN 256 256 256 GLN GLN A . n A 1 257 ASN 257 257 257 ASN ASN A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 VAL 259 259 259 VAL VAL A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 TYR 261 261 261 TYR TYR A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 VAL 264 264 264 VAL VAL A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 GLY 266 266 266 GLY GLY A . n A 1 267 PRO 267 267 267 PRO PRO A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 ASP 269 269 269 ASP ASP A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 TYR 272 272 272 TYR TYR A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 PRO 274 274 274 PRO PRO A . n A 1 275 MSE 275 275 275 MSE MSE A . n A 1 276 TYR 276 276 276 TYR TYR A . n A 1 277 TRP 277 277 277 TRP TRP A . n A 1 278 TRP 278 278 278 TRP TRP A . n A 1 279 HIS 279 279 279 HIS HIS A . n A 1 280 HIS 280 280 280 HIS HIS A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 SER 283 283 283 SER SER A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 ASN 286 286 286 ASN ASN A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 THR 290 290 290 THR THR A . n A 1 291 ILE 291 291 291 ILE ILE A . n A 1 292 THR 292 292 292 THR THR A . n A 1 293 VAL 293 293 293 VAL VAL A . n A 1 294 ASN 294 294 294 ASN ASN A . n A 1 295 PHE 295 295 295 PHE PHE A . n A 1 296 TRP 296 296 296 TRP TRP A . n A 1 297 TYR 297 297 297 TYR TYR A . n A 1 298 LYS 298 298 298 LYS LYS A . n A 1 299 GLY 299 299 299 GLY GLY A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 PRO 301 301 301 PRO PRO A . n A 1 302 THR 302 302 302 THR THR A . n A 1 303 PRO 303 303 303 PRO PRO A . n A 1 304 LYS 304 304 304 LYS LYS A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 ILE 306 306 306 ILE ILE A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 TYR 308 308 308 TYR TYR A . n A 1 309 PRO 309 309 309 PRO CPR A . n A 1 310 LEU 310 310 310 LEU LEU A . n A 1 311 LYS 311 311 311 LYS LYS A . n A 1 312 ALA 312 312 312 ALA ALA A . n A 1 313 HIS 313 313 313 HIS HIS A . n A 1 314 GLN 314 314 314 GLN GLN A . n A 1 315 LYS 315 315 315 LYS LYS A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 ILE 318 318 318 ILE ILE A . n A 1 319 MSE 319 319 319 MSE MSE A . n A 1 320 ARG 320 320 320 ARG ARG A . n A 1 321 ASN 321 321 321 ASN ASN A . n A 1 322 ILE 322 322 322 ILE ILE A . n A 1 323 GLU 323 323 323 GLU GLU A . n A 1 324 LYS 324 324 324 LYS LYS A . n A 1 325 MSE 325 325 325 MSE MSE A . n A 1 326 LEU 326 326 326 LEU LEU A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 LEU 330 330 330 LEU LEU A . n A 1 331 GLY 331 331 331 GLY GLY A . n A 1 332 ASN 332 332 332 ASN ASN A . n A 1 333 PRO 333 333 333 PRO PRO A . n A 1 334 GLN 334 334 334 GLN GLN A . n A 1 335 GLU 335 335 335 GLU GLU A . n A 1 336 VAL 336 336 336 VAL VAL A . n A 1 337 GLY 337 337 337 GLY GLY A . n A 1 338 PRO 338 338 338 PRO PRO A . n A 1 339 LEU 339 339 339 LEU LEU A . n A 1 340 LEU 340 340 340 LEU LEU A . n A 1 341 ASN 341 341 341 ASN ASN A . n A 1 342 THR 342 342 342 THR THR A . n A 1 343 MSE 343 343 343 MSE MSE A . n A 1 344 ILE 344 344 344 ILE ILE A . n A 1 345 LYS 345 345 345 LYS LYS A . n A 1 346 GLY 346 346 346 GLY GLY A . n A 1 347 ARG 347 347 347 ARG ARG A . n A 1 348 TYR 348 348 348 TYR TYR A . n A 1 349 ASN 349 349 349 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id SO4 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 501 _pdbx_nonpoly_scheme.auth_seq_num 501 _pdbx_nonpoly_scheme.pdb_mon_id SO4 _pdbx_nonpoly_scheme.auth_mon_id SO4 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 SHARP phasing . ? 3 CNS refinement 0.9 ? 4 # _cell.entry_id 1IZ3 _cell.length_a 86.89 _cell.length_b 86.89 _cell.length_c 143.42 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 90 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 # _symmetry.entry_id 1IZ3 _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 92 _symmetry.cell_setting ? # _exptl.entry_id 1IZ3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 64.38 _exptl_crystal.density_Matthews 3.48 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details '0.4M Lithium sulfate, 20% PEG 4000, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MACSCIENCE _diffrn_detector.pdbx_collection_date 2002-07-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator graphite _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 6B' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline 6B _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979 # _reflns.entry_id 1IZ3 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.8 _reflns.d_resolution_low 99 _reflns.number_all 25821 _reflns.number_obs 24716 _reflns.percent_possible_obs 95.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 50 _reflns_shell.percent_possible_all 95.7 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1IZ3 _refine.ls_d_res_high 2.8 _refine.ls_d_res_low 50 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 25821 _refine.ls_number_reflns_obs 24716 _refine.ls_number_reflns_R_free 1169 _refine.ls_percent_reflns_obs 95.7 _refine.ls_R_factor_all 0.236 _refine.ls_R_factor_obs 0.236 _refine.ls_R_factor_R_work 0.23 _refine.ls_R_factor_R_free 0.277 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2773 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2778 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low 50 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.47 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.2 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.8 _refine_ls_shell.d_res_low 50 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _database_PDB_matrix.entry_id 1IZ3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1IZ3 _struct.title 'Dimeric structure of FIH (Factor inhibiting HIF)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IZ3 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'double Beta-sheet helix, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HIF1N_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAATAAEAVTSGSGEPREEAGALGPAWHESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEY LQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGGKIVM DFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMR NIEKMLGEALGNPQEVGPLLNTMIKGRYN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q9NWT6 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IZ3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 349 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NWT6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 349 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 349 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1IZ3 ASP A 28 ? UNP Q9NWT6 HIS 28 conflict 28 1 1 1IZ3 MSE A 108 ? UNP Q9NWT6 MET 108 'modified residue' 108 2 1 1IZ3 MSE A 123 ? UNP Q9NWT6 MET 123 'modified residue' 123 3 1 1IZ3 MSE A 160 ? UNP Q9NWT6 MET 160 'modified residue' 160 4 1 1IZ3 MSE A 191 ? UNP Q9NWT6 MET 191 'modified residue' 191 5 1 1IZ3 MSE A 275 ? UNP Q9NWT6 MET 275 'modified residue' 275 6 1 1IZ3 MSE A 319 ? UNP Q9NWT6 MET 319 'modified residue' 319 7 1 1IZ3 MSE A 325 ? UNP Q9NWT6 MET 325 'modified residue' 325 8 1 1IZ3 MSE A 343 ? UNP Q9NWT6 MET 343 'modified residue' 343 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3450 ? 1 MORE -51 ? 1 'SSA (A^2)' 31630 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 143.4200000000 # _struct_biol.id 1 _struct_biol.details 'The second part of the biological assembly is generated by the two fold axis : -x, y, -z' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 28 ? LEU A 32 ? ASP A 28 LEU A 32 5 ? 5 HELX_P HELX_P2 2 ASP A 49 ? ASN A 58 ? ASP A 49 ASN A 58 1 ? 10 HELX_P HELX_P3 3 VAL A 70 ? TRP A 76 ? VAL A 70 TRP A 76 5 ? 7 HELX_P HELX_P4 4 ASP A 77 ? ILE A 85 ? ASP A 77 ILE A 85 1 ? 9 HELX_P HELX_P5 5 ASP A 104 ? GLN A 112 ? ASP A 104 GLN A 112 5 ? 9 HELX_P HELX_P6 6 PHE A 125 ? GLY A 139 ? PHE A 125 GLY A 139 1 ? 15 HELX_P HELX_P7 7 GLY A 155 ? PHE A 165 ? GLY A 155 PHE A 165 1 ? 11 HELX_P HELX_P8 8 ASN A 166 ? ARG A 177 ? ASN A 166 ARG A 177 1 ? 12 HELX_P HELX_P9 9 PRO A 220 ? ASP A 222 ? PRO A 220 ASP A 222 5 ? 3 HELX_P HELX_P10 10 GLN A 223 ? TYR A 228 ? GLN A 223 TYR A 228 1 ? 6 HELX_P HELX_P11 11 PHE A 252 ? VAL A 258 ? PHE A 252 VAL A 258 5 ? 7 HELX_P HELX_P12 12 LYS A 311 ? GLY A 331 ? LYS A 311 GLY A 331 1 ? 21 HELX_P HELX_P13 13 ASN A 332 ? GLN A 334 ? ASN A 332 GLN A 334 5 ? 3 HELX_P HELX_P14 14 GLU A 335 ? LYS A 345 ? GLU A 335 LYS A 345 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LYS 107 C ? ? ? 1_555 A MSE 108 N ? ? A LYS 107 A MSE 108 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A MSE 108 C ? ? ? 1_555 A ALA 109 N ? ? A MSE 108 A ALA 109 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale3 covale both ? A GLU 122 C ? ? ? 1_555 A MSE 123 N ? ? A GLU 122 A MSE 123 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A MSE 123 C ? ? ? 1_555 A LYS 124 N ? ? A MSE 123 A LYS 124 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale5 covale both ? A VAL 159 C ? ? ? 1_555 A MSE 160 N ? ? A VAL 159 A MSE 160 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A MSE 160 C ? ? ? 1_555 A ASP 161 N ? ? A MSE 160 A ASP 161 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale7 covale both ? A GLY 190 C ? ? ? 1_555 A MSE 191 N ? ? A GLY 190 A MSE 191 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale8 covale both ? A MSE 191 C ? ? ? 1_555 A GLU 192 N ? ? A MSE 191 A GLU 192 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale9 covale both ? A PRO 274 C ? ? ? 1_555 A MSE 275 N ? ? A PRO 274 A MSE 275 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale10 covale both ? A MSE 275 C ? ? ? 1_555 A TYR 276 N ? ? A MSE 275 A TYR 276 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale11 covale both ? A ILE 318 C ? ? ? 1_555 A MSE 319 N ? ? A ILE 318 A MSE 319 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale12 covale both ? A MSE 319 C ? ? ? 1_555 A ARG 320 N ? ? A MSE 319 A ARG 320 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale13 covale both ? A LYS 324 C ? ? ? 1_555 A MSE 325 N ? ? A LYS 324 A MSE 325 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale14 covale both ? A MSE 325 C ? ? ? 1_555 A LEU 326 N ? ? A MSE 325 A LEU 326 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale15 covale both ? A THR 342 C ? ? ? 1_555 A MSE 343 N ? ? A THR 342 A MSE 343 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale16 covale both ? A MSE 343 C ? ? ? 1_555 A ILE 344 N ? ? A MSE 343 A ILE 344 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 308 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 308 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 309 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 309 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.40 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel B 7 8 ? anti-parallel B 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 39 ? PRO A 41 ? THR A 39 PRO A 41 A 2 GLY A 260 ? VAL A 265 ? GLY A 260 VAL A 265 A 3 LYS A 214 ? PHE A 219 ? LYS A 214 PHE A 219 A 4 TRP A 278 ? SER A 283 ? TRP A 278 SER A 283 A 5 VAL A 195 ? TYR A 200 ? VAL A 195 TYR A 200 B 1 ARG A 44 ? LEU A 45 ? ARG A 44 LEU A 45 B 2 VAL A 63 ? LEU A 64 ? VAL A 63 LEU A 64 B 3 VAL A 270 ? ILE A 273 ? VAL A 270 ILE A 273 B 4 GLN A 204 ? LYS A 211 ? GLN A 204 LYS A 211 B 5 THR A 290 ? TYR A 297 ? THR A 290 TYR A 297 B 6 LEU A 182 ? GLY A 190 ? LEU A 182 GLY A 190 B 7 ARG A 143 ? THR A 149 ? ARG A 143 THR A 149 B 8 ASP A 89 ? ALA A 95 ? ASP A 89 ALA A 95 B 9 ASN A 119 ? LYS A 124 ? ASN A 119 LYS A 124 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 40 ? N ARG A 40 O GLU A 262 ? O GLU A 262 A 2 3 O THR A 263 ? O THR A 263 N CYS A 216 ? N CYS A 216 A 3 4 N ARG A 215 ? N ARG A 215 O GLU A 282 ? O GLU A 282 A 4 5 O ILE A 281 ? O ILE A 281 N THR A 196 ? N THR A 196 B 1 2 N LEU A 45 ? N LEU A 45 O VAL A 63 ? O VAL A 63 B 2 3 N LEU A 64 ? N LEU A 64 O VAL A 270 ? O VAL A 270 B 3 4 O ILE A 273 ? O ILE A 273 N ASN A 205 ? N ASN A 205 B 4 5 N ALA A 208 ? N ALA A 208 O VAL A 293 ? O VAL A 293 B 5 6 O THR A 292 ? O THR A 292 N LEU A 188 ? N LEU A 188 B 6 7 O LEU A 187 ? O LEU A 187 N GLN A 148 ? N GLN A 148 B 7 8 O TYR A 145 ? O TYR A 145 N TYR A 93 ? N TYR A 93 B 8 9 N SER A 94 ? N SER A 94 O ASN A 119 ? O ASN A 119 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 107 ? LYS A 107 . ? 1_555 ? 2 AC1 4 ARG A 238 ? ARG A 238 . ? 1_555 ? 3 AC1 4 ARG A 320 ? ARG A 320 . ? 1_555 ? 4 AC1 4 LYS A 324 ? LYS A 324 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 202 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 238 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CD1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ILE _pdbx_validate_symm_contact.auth_seq_id_1 344 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CD1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ILE _pdbx_validate_symm_contact.auth_seq_id_2 344 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_556 _pdbx_validate_symm_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 22 ? ? 37.05 41.47 2 1 SER A 36 ? ? -89.43 39.30 3 1 LEU A 74 ? ? -55.94 -6.82 4 1 ASN A 87 ? ? -45.91 -70.10 5 1 LYS A 106 ? ? -48.96 -10.18 6 1 GLN A 112 ? ? -42.14 -17.74 7 1 GLU A 130 ? ? -54.22 -76.05 8 1 GLU A 141 ? ? -91.21 -95.67 9 1 TYR A 145 ? ? -160.44 101.34 10 1 LEU A 150 ? ? -97.80 50.89 11 1 THR A 153 ? ? -61.80 97.41 12 1 TRP A 179 ? ? -58.23 175.05 13 1 GLN A 181 ? ? -35.46 145.58 14 1 HIS A 199 ? ? -171.53 -179.21 15 1 ILE A 210 ? ? -131.83 -67.28 16 1 TYR A 228 ? ? 48.70 73.99 17 1 ARG A 238 ? ? 85.56 -1.70 18 1 ASN A 246 ? ? -171.36 67.41 19 1 ASP A 248 ? ? -110.78 78.63 20 1 TYR A 249 ? ? -55.18 -8.78 21 1 PRO A 267 ? ? -17.42 -62.12 22 1 TYR A 276 ? ? 72.74 -19.93 23 1 ASN A 332 ? ? 163.10 97.19 24 1 PRO A 333 ? ? -48.13 -19.22 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 108 A MSE 108 ? MET SELENOMETHIONINE 2 A MSE 123 A MSE 123 ? MET SELENOMETHIONINE 3 A MSE 160 A MSE 160 ? MET SELENOMETHIONINE 4 A MSE 191 A MSE 191 ? MET SELENOMETHIONINE 5 A MSE 275 A MSE 275 ? MET SELENOMETHIONINE 6 A MSE 319 A MSE 319 ? MET SELENOMETHIONINE 7 A MSE 325 A MSE 325 ? MET SELENOMETHIONINE 8 A MSE 343 A MSE 343 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A THR 10 ? A THR 10 11 1 Y 1 A SER 11 ? A SER 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MSE N N N N 247 MSE CA C N S 248 MSE C C N N 249 MSE O O N N 250 MSE OXT O N N 251 MSE CB C N N 252 MSE CG C N N 253 MSE SE SE N N 254 MSE CE C N N 255 MSE H H N N 256 MSE H2 H N N 257 MSE HA H N N 258 MSE HXT H N N 259 MSE HB2 H N N 260 MSE HB3 H N N 261 MSE HG2 H N N 262 MSE HG3 H N N 263 MSE HE1 H N N 264 MSE HE2 H N N 265 MSE HE3 H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 SO4 S S N N 321 SO4 O1 O N N 322 SO4 O2 O N N 323 SO4 O3 O N N 324 SO4 O4 O N N 325 THR N N N N 326 THR CA C N S 327 THR C C N N 328 THR O O N N 329 THR CB C N R 330 THR OG1 O N N 331 THR CG2 C N N 332 THR OXT O N N 333 THR H H N N 334 THR H2 H N N 335 THR HA H N N 336 THR HB H N N 337 THR HG1 H N N 338 THR HG21 H N N 339 THR HG22 H N N 340 THR HG23 H N N 341 THR HXT H N N 342 TRP N N N N 343 TRP CA C N S 344 TRP C C N N 345 TRP O O N N 346 TRP CB C N N 347 TRP CG C Y N 348 TRP CD1 C Y N 349 TRP CD2 C Y N 350 TRP NE1 N Y N 351 TRP CE2 C Y N 352 TRP CE3 C Y N 353 TRP CZ2 C Y N 354 TRP CZ3 C Y N 355 TRP CH2 C Y N 356 TRP OXT O N N 357 TRP H H N N 358 TRP H2 H N N 359 TRP HA H N N 360 TRP HB2 H N N 361 TRP HB3 H N N 362 TRP HD1 H N N 363 TRP HE1 H N N 364 TRP HE3 H N N 365 TRP HZ2 H N N 366 TRP HZ3 H N N 367 TRP HH2 H N N 368 TRP HXT H N N 369 TYR N N N N 370 TYR CA C N S 371 TYR C C N N 372 TYR O O N N 373 TYR CB C N N 374 TYR CG C Y N 375 TYR CD1 C Y N 376 TYR CD2 C Y N 377 TYR CE1 C Y N 378 TYR CE2 C Y N 379 TYR CZ C Y N 380 TYR OH O N N 381 TYR OXT O N N 382 TYR H H N N 383 TYR H2 H N N 384 TYR HA H N N 385 TYR HB2 H N N 386 TYR HB3 H N N 387 TYR HD1 H N N 388 TYR HD2 H N N 389 TYR HE1 H N N 390 TYR HE2 H N N 391 TYR HH H N N 392 TYR HXT H N N 393 VAL N N N N 394 VAL CA C N S 395 VAL C C N N 396 VAL O O N N 397 VAL CB C N N 398 VAL CG1 C N N 399 VAL CG2 C N N 400 VAL OXT O N N 401 VAL H H N N 402 VAL H2 H N N 403 VAL HA H N N 404 VAL HB H N N 405 VAL HG11 H N N 406 VAL HG12 H N N 407 VAL HG13 H N N 408 VAL HG21 H N N 409 VAL HG22 H N N 410 VAL HG23 H N N 411 VAL HXT H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 MSE N CA sing N N 235 MSE N H sing N N 236 MSE N H2 sing N N 237 MSE CA C sing N N 238 MSE CA CB sing N N 239 MSE CA HA sing N N 240 MSE C O doub N N 241 MSE C OXT sing N N 242 MSE OXT HXT sing N N 243 MSE CB CG sing N N 244 MSE CB HB2 sing N N 245 MSE CB HB3 sing N N 246 MSE CG SE sing N N 247 MSE CG HG2 sing N N 248 MSE CG HG3 sing N N 249 MSE SE CE sing N N 250 MSE CE HE1 sing N N 251 MSE CE HE2 sing N N 252 MSE CE HE3 sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 SO4 S O1 doub N N 307 SO4 S O2 doub N N 308 SO4 S O3 sing N N 309 SO4 S O4 sing N N 310 THR N CA sing N N 311 THR N H sing N N 312 THR N H2 sing N N 313 THR CA C sing N N 314 THR CA CB sing N N 315 THR CA HA sing N N 316 THR C O doub N N 317 THR C OXT sing N N 318 THR CB OG1 sing N N 319 THR CB CG2 sing N N 320 THR CB HB sing N N 321 THR OG1 HG1 sing N N 322 THR CG2 HG21 sing N N 323 THR CG2 HG22 sing N N 324 THR CG2 HG23 sing N N 325 THR OXT HXT sing N N 326 TRP N CA sing N N 327 TRP N H sing N N 328 TRP N H2 sing N N 329 TRP CA C sing N N 330 TRP CA CB sing N N 331 TRP CA HA sing N N 332 TRP C O doub N N 333 TRP C OXT sing N N 334 TRP CB CG sing N N 335 TRP CB HB2 sing N N 336 TRP CB HB3 sing N N 337 TRP CG CD1 doub Y N 338 TRP CG CD2 sing Y N 339 TRP CD1 NE1 sing Y N 340 TRP CD1 HD1 sing N N 341 TRP CD2 CE2 doub Y N 342 TRP CD2 CE3 sing Y N 343 TRP NE1 CE2 sing Y N 344 TRP NE1 HE1 sing N N 345 TRP CE2 CZ2 sing Y N 346 TRP CE3 CZ3 doub Y N 347 TRP CE3 HE3 sing N N 348 TRP CZ2 CH2 doub Y N 349 TRP CZ2 HZ2 sing N N 350 TRP CZ3 CH2 sing Y N 351 TRP CZ3 HZ3 sing N N 352 TRP CH2 HH2 sing N N 353 TRP OXT HXT sing N N 354 TYR N CA sing N N 355 TYR N H sing N N 356 TYR N H2 sing N N 357 TYR CA C sing N N 358 TYR CA CB sing N N 359 TYR CA HA sing N N 360 TYR C O doub N N 361 TYR C OXT sing N N 362 TYR CB CG sing N N 363 TYR CB HB2 sing N N 364 TYR CB HB3 sing N N 365 TYR CG CD1 doub Y N 366 TYR CG CD2 sing Y N 367 TYR CD1 CE1 sing Y N 368 TYR CD1 HD1 sing N N 369 TYR CD2 CE2 doub Y N 370 TYR CD2 HD2 sing N N 371 TYR CE1 CZ doub Y N 372 TYR CE1 HE1 sing N N 373 TYR CE2 CZ sing Y N 374 TYR CE2 HE2 sing N N 375 TYR CZ OH sing N N 376 TYR OH HH sing N N 377 TYR OXT HXT sing N N 378 VAL N CA sing N N 379 VAL N H sing N N 380 VAL N H2 sing N N 381 VAL CA C sing N N 382 VAL CA CB sing N N 383 VAL CA HA sing N N 384 VAL C O doub N N 385 VAL C OXT sing N N 386 VAL CB CG1 sing N N 387 VAL CB CG2 sing N N 388 VAL CB HB sing N N 389 VAL CG1 HG11 sing N N 390 VAL CG1 HG12 sing N N 391 VAL CG1 HG13 sing N N 392 VAL CG2 HG21 sing N N 393 VAL CG2 HG22 sing N N 394 VAL CG2 HG23 sing N N 395 VAL OXT HXT sing N N 396 # _atom_sites.entry_id 1IZ3 _atom_sites.fract_transf_matrix[1][1] 0.011509 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011509 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006973 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_