data_1J15 # _entry.id 1J15 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1J15 pdb_00001j15 10.2210/pdb1j15/pdb RCSB RCSB005499 ? ? WWPDB D_1000005499 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1ql7 . unspecified PDB 1ql8 . unspecified PDB 1ql9 . unspecified PDB 1J14 'BENZAMIDINE in complex with RAT TRYPSIN mutant X99RT' unspecified PDB 1J16 'BENZAMIDINE in complex with RAT TRYPSIN mutant X99/175/190RT at 100K' unspecified PDB 1J17 'factor XA specific inhibitor in complex with RAT TRYPSIN mutant X99/175/190RT' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1J15 _pdbx_database_status.recvd_initial_deposition_date 2002-11-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Stubbs, M.T.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity' J.MOL.BIOL. 325 963 977 2003 JMOBAK UK 0022-2836 0070 ? 12527302 '10.1016/S0022-2836(02)01337-2' 1 'pH-dependent binding modes observed in trypsin crystals: lessons for structure-based drug design' Chembiochem 3 246 249 2002 ? GE 1439-4227 ? ? ? '10.1002/1439-7633(20020301)3:2/3<246::AID-CBIC246>3.0.CO;2-#' 2 ;Structural and functional analyses of benzamidine-based inhibitors in complex with trypsin: implications for the inhibition of factor Xa, tPA, and urokinas ; J.MED.CHEM. 41 5445 5456 1998 JMCMAR US 0022-2623 0151 ? ? 10.1021/jm981068g 3 'Structural Aspects of Factor Xa Inhibition' Curr.Pharm.Des. 2 543 552 1996 CPDEFP NE 1381-6128 2127 ? ? ? 4 ;Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin ; 'FEBS LETT.' 375 103 107 1995 FEBLAL NE 0014-5793 0165 ? ? '10.1016/0014-5793(95)01190-P' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Reyda, S.' 1 ? primary 'Sohn, C.' 2 ? primary 'Klebe, G.' 3 ? primary 'Rall, K.' 4 ? primary 'Ullmann, D.' 5 ? primary 'Jakubke, H.D.' 6 ? primary 'Stubbs, M.T.' 7 ? 1 'Stubbs, M.T.' 8 ? 1 'Reyda, S.' 9 ? 1 'Dullweber, F.' 10 ? 1 'Moeller, M.' 11 ? 1 'Klebe, G.' 12 ? 1 'Dorsch, D.' 13 ? 1 'Mederski, W.W.K.R.' 14 ? 1 'Wurziger, H.' 15 ? 2 'Renatus, M.' 16 ? 2 'Bode, W.' 17 ? 2 'Huber, R.' 18 ? 2 'Stuerzebecher, J.' 19 ? 2 'Stubbs, M.T.' 20 ? 3 'Stubbs, M.T.' 21 ? 4 'Stubbs, M.T.' 22 ? 4 'Huber, R.' 23 ? 4 'Bode, W.' 24 ? # _cell.entry_id 1J15 _cell.length_a 124.70 _cell.length_b 124.70 _cell.length_c 124.70 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.pdbx_unique_axis ? _cell.Z_PDB 24 # _symmetry.entry_id 1J15 _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 197 _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Trypsin II, anionic' 23836.756 1 3.4.21.4 'K97E, L99Y, S190A, Y172S, P173S, G174F, K175I' ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn BENZAMIDINE 120.152 3 ? ? ? ? 5 water nat water 18.015 152 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TRYPSINOGEN, BETA-TRYPSIN, Pretrypsinogen II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRET YNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNM VCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRET YNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNM VCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 GLN n 1 9 GLU n 1 10 ASN n 1 11 SER n 1 12 VAL n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASN n 1 32 ASP n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 ARG n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 HIS n 1 54 ASN n 1 55 ILE n 1 56 ASN n 1 57 VAL n 1 58 LEU n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 VAL n 1 66 ASN n 1 67 ALA n 1 68 ALA n 1 69 LYS n 1 70 ILE n 1 71 ILE n 1 72 LYS n 1 73 HIS n 1 74 PRO n 1 75 ASN n 1 76 PHE n 1 77 ASP n 1 78 ARG n 1 79 GLU n 1 80 THR n 1 81 TYR n 1 82 ASN n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 SER n 1 92 SER n 1 93 PRO n 1 94 VAL n 1 95 LYS n 1 96 LEU n 1 97 ASN n 1 98 ALA n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 THR n 1 103 VAL n 1 104 ALA n 1 105 LEU n 1 106 PRO n 1 107 SER n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 PRO n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LEU n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 VAL n 1 130 ASN n 1 131 GLU n 1 132 PRO n 1 133 ASP n 1 134 LEU n 1 135 LEU n 1 136 GLN n 1 137 CYS n 1 138 LEU n 1 139 ASP n 1 140 ALA n 1 141 PRO n 1 142 LEU n 1 143 LEU n 1 144 PRO n 1 145 GLN n 1 146 ALA n 1 147 ASP n 1 148 CYS n 1 149 GLU n 1 150 ALA n 1 151 SER n 1 152 SER n 1 153 SER n 1 154 PHE n 1 155 ILE n 1 156 ILE n 1 157 THR n 1 158 ASP n 1 159 ASN n 1 160 MET n 1 161 VAL n 1 162 CYS n 1 163 VAL n 1 164 GLY n 1 165 PHE n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 ASP n 1 172 ALA n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 ASN n 1 185 GLY n 1 186 GLU n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 TYR n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 LEU n 1 200 PRO n 1 201 ASP n 1 202 ASN n 1 203 PRO n 1 204 GLY n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 ASP n 1 215 TRP n 1 216 ILE n 1 217 GLN n 1 218 ASP n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 ALA n 1 223 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue pancreas _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ;baker's yeast ; _entity_src_gen.pdbx_host_org_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4932 _entity_src_gen.host_org_genus Saccharomyces _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pyt _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY2_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKT LNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNM VCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_accession P00763 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1J15 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00763 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 246 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1J15 GLU A 79 ? UNP P00763 LYS 102 'engineered mutation' 97 1 1 1J15 TYR A 81 ? UNP P00763 LEU 104 'engineered mutation' 99 2 1 1J15 SER A 152 ? UNP P00763 TYR 175 'engineered mutation' 172 3 1 1J15 SER A 153 ? UNP P00763 PRO 176 'engineered mutation' 173 4 1 1J15 PHE A 154 ? UNP P00763 GLY 177 'engineered mutation' 174 5 1 1J15 ILE A 155 ? UNP P00763 LYS 178 'engineered mutation' 175 6 1 1J15 ALA A 172 ? UNP P00763 SER 195 'engineered mutation' 190 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEN non-polymer . BENZAMIDINE ? 'C7 H8 N2' 120.152 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1J15 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.11 _exptl_crystal.density_percent_sol 60.20 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details 'pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 287 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2000-02-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU300' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1J15 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 33.33 _reflns.number_all ? _reflns.number_obs 21903 _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1J15 _refine.ls_d_res_high 2.0 _refine.ls_d_res_low 10.0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21715 _refine.ls_number_reflns_R_free ? _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.173 _refine.ls_R_factor_R_free ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1742 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 152 _refine_hist.number_atoms_total 1927 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 10.0 # _struct.entry_id 1J15 _struct.title 'BENZAMIDINE IN COMPLEX WITH RAT TRYPSIN MUTANT X99/175/190RT' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1J15 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'SERINE PROTEASE, HYDROLASE, SERINE PROTEINASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 5 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 38 ? TYR A 42 ? ALA A 55 TYR A 59 5 ? 5 HELX_P HELX_P2 2 PRO A 144 ? ALA A 150 ? PRO A 164 ALA A 170 1 ? 7 HELX_P HELX_P3 3 TYR A 212 ? ASN A 223 ? TYR A 234 ASN A 245 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.016 ? ? metalc1 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 70 A CA 480 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc2 metalc ? ? A ASN 54 O ? ? ? 1_555 B CA . CA ? ? A ASN 72 A CA 480 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc3 metalc ? ? A VAL 57 O ? ? ? 1_555 B CA . CA ? ? A VAL 75 A CA 480 1_555 ? ? ? ? ? ? ? 2.207 ? ? metalc4 metalc ? ? A GLU 59 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 77 A CA 480 1_555 ? ? ? ? ? ? ? 2.702 ? ? metalc5 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 80 A CA 480 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc6 metalc ? ? G HOH . O ? ? ? 1_555 B CA . CA ? ? A HOH 261 A CA 480 1_555 ? ? ? ? ? ? ? 2.234 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 5 ? THR A 6 ? TYR A 20 THR A 21 A 2 GLN A 136 ? PRO A 141 ? GLN A 156 PRO A 161 A 3 GLN A 115 ? GLY A 120 ? GLN A 135 GLY A 140 A 4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 A 5 GLU A 186 ? TRP A 193 ? GLU A 204 TRP A 215 A 6 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 A 7 MET A 160 ? VAL A 163 ? MET A 180 VAL A 183 B 1 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 B 2 HIS A 23 ? ASN A 31 ? HIS A 40 ASN A 48 B 3 TRP A 34 ? SER A 37 ? TRP A 51 SER A 54 B 4 MET A 86 ? LEU A 90 ? MET A 104 LEU A 108 B 5 GLN A 63 ? LYS A 72 ? GLN A 81 LYS A 90 B 6 GLN A 47 ? LEU A 50 ? GLN A 64 LEU A 68 B 7 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 5 ? N TYR A 20 O CYS A 137 ? O CYS A 157 A 2 3 O ALA A 140 ? O ALA A 160 N CYS A 116 ? N CYS A 136 A 3 4 N LEU A 117 ? N LEU A 137 O VAL A 182 ? O VAL A 200 A 4 5 N VAL A 181 ? N VAL A 199 O GLN A 188 ? O GLN A 210 A 5 6 N TRP A 193 ? N TRP A 215 O VAL A 205 ? O VAL A 227 A 6 7 O TYR A 206 ? O TYR A 228 N VAL A 161 ? N VAL A 181 B 1 2 N LEU A 18 ? N LEU A 33 O CYS A 25 ? O CYS A 42 B 2 3 N SER A 28 ? N SER A 45 O VAL A 36 ? O VAL A 53 B 3 4 N VAL A 35 ? N VAL A 52 O ILE A 88 ? O ILE A 106 B 4 5 O LEU A 87 ? O LEU A 105 N ILE A 71 ? N ILE A 89 B 5 6 O VAL A 65 ? O VAL A 83 N VAL A 48 ? N VAL A 66 B 6 7 O GLN A 47 ? O GLN A 64 N ASN A 19 ? N ASN A 34 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 480 ? 6 'BINDING SITE FOR RESIDUE CA A 480' AC2 Software A SO4 600 ? 7 'BINDING SITE FOR RESIDUE SO4 A 600' AC3 Software A BEN 1 ? 10 'BINDING SITE FOR RESIDUE BEN A 1' AC4 Software A BEN 2 ? 6 'BINDING SITE FOR RESIDUE BEN A 2' AC5 Software A BEN 3 ? 7 'BINDING SITE FOR RESIDUE BEN A 3' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 52 ? GLU A 70 . ? 1_555 ? 2 AC1 6 ASN A 54 ? ASN A 72 . ? 1_555 ? 3 AC1 6 VAL A 57 ? VAL A 75 . ? 1_555 ? 4 AC1 6 GLU A 59 ? GLU A 77 . ? 1_555 ? 5 AC1 6 GLU A 62 ? GLU A 80 . ? 1_555 ? 6 AC1 6 HOH G . ? HOH A 261 . ? 1_555 ? 7 AC2 7 BEN D . ? BEN A 1 . ? 1_555 ? 8 AC2 7 HIS A 40 ? HIS A 57 . ? 1_555 ? 9 AC2 7 GLN A 174 ? GLN A 192 . ? 1_555 ? 10 AC2 7 GLY A 175 ? GLY A 193 . ? 1_555 ? 11 AC2 7 SER A 177 ? SER A 195 . ? 1_555 ? 12 AC2 7 HOH G . ? HOH A 726 . ? 1_555 ? 13 AC2 7 HOH G . ? HOH A 727 . ? 1_555 ? 14 AC3 10 ASP A 171 ? ASP A 189 . ? 1_555 ? 15 AC3 10 ALA A 172 ? ALA A 190 . ? 1_555 ? 16 AC3 10 CYS A 173 ? CYS A 191 . ? 1_555 ? 17 AC3 10 GLN A 174 ? GLN A 192 . ? 1_555 ? 18 AC3 10 SER A 177 ? SER A 195 . ? 1_555 ? 19 AC3 10 GLY A 194 ? GLY A 216 . ? 1_555 ? 20 AC3 10 GLY A 196 ? GLY A 219 . ? 1_555 ? 21 AC3 10 GLY A 204 ? GLY A 226 . ? 1_555 ? 22 AC3 10 HOH G . ? HOH A 502 . ? 1_555 ? 23 AC3 10 SO4 C . ? SO4 A 600 . ? 1_555 ? 24 AC4 6 BEN F . ? BEN A 3 . ? 3_556 ? 25 AC4 6 BEN F . ? BEN A 3 . ? 4_566 ? 26 AC4 6 ALA A 198 ? ALA A 221 . ? 2_565 ? 27 AC4 6 ALA A 198 ? ALA A 221 . ? 1_555 ? 28 AC4 6 PRO A 200 ? PRO A 222 . ? 2_565 ? 29 AC4 6 PRO A 200 ? PRO A 222 . ? 1_555 ? 30 AC5 7 BEN E . ? BEN A 2 . ? 3_556 ? 31 AC5 7 BEN E . ? BEN A 2 . ? 4_566 ? 32 AC5 7 TYR A 195 ? TYR A 217 . ? 4_566 ? 33 AC5 7 LEU A 199 A LEU A 221 . ? 1_555 ? 34 AC5 7 LEU A 199 A LEU A 221 . ? 4_566 ? 35 AC5 7 PRO A 200 ? PRO A 222 . ? 1_555 ? 36 AC5 7 ASN A 202 ? ASN A 224 . ? 1_555 ? # _database_PDB_matrix.entry_id 1J15 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1J15 _atom_sites.fract_transf_matrix[1][1] 0.008019 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008019 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008019 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 TYR 5 20 20 TYR TYR A . n A 1 6 THR 6 21 21 THR THR A . n A 1 7 CYS 7 22 22 CYS CYS A . n A 1 8 GLN 8 23 23 GLN GLN A . n A 1 9 GLU 9 24 24 GLU GLU A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 SER 11 26 26 SER SER A . n A 1 12 VAL 12 27 27 VAL VAL A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 ASN 19 34 34 ASN ASN A . n A 1 20 SER 20 37 37 SER SER A . n A 1 21 GLY 21 38 38 GLY GLY A . n A 1 22 TYR 22 39 39 TYR TYR A . n A 1 23 HIS 23 40 40 HIS HIS A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 CYS 25 42 42 CYS CYS A . n A 1 26 GLY 26 43 43 GLY GLY A . n A 1 27 GLY 27 44 44 GLY GLY A . n A 1 28 SER 28 45 45 SER SER A . n A 1 29 LEU 29 46 46 LEU LEU A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ASN 31 48 48 ASN ASN A . n A 1 32 ASP 32 49 49 ASP ASP A . n A 1 33 GLN 33 50 50 GLN GLN A . n A 1 34 TRP 34 51 51 TRP TRP A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 VAL 36 53 53 VAL VAL A . n A 1 37 SER 37 54 54 SER SER A . n A 1 38 ALA 38 55 55 ALA ALA A . n A 1 39 ALA 39 56 56 ALA ALA A . n A 1 40 HIS 40 57 57 HIS HIS A . n A 1 41 CYS 41 58 58 CYS CYS A . n A 1 42 TYR 42 59 59 TYR TYR A . n A 1 43 LYS 43 60 60 LYS LYS A . n A 1 44 SER 44 61 61 SER SER A . n A 1 45 ARG 45 62 62 ARG ARG A . n A 1 46 ILE 46 63 63 ILE ILE A . n A 1 47 GLN 47 64 64 GLN GLN A . n A 1 48 VAL 48 66 66 VAL VAL A . n A 1 49 ARG 49 67 67 ARG ARG A . n A 1 50 LEU 50 68 68 LEU LEU A . n A 1 51 GLY 51 69 69 GLY GLY A . n A 1 52 GLU 52 70 70 GLU GLU A . n A 1 53 HIS 53 71 71 HIS HIS A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 ILE 55 73 73 ILE ILE A . n A 1 56 ASN 56 74 74 ASN ASN A . n A 1 57 VAL 57 75 75 VAL VAL A . n A 1 58 LEU 58 76 76 LEU LEU A . n A 1 59 GLU 59 77 77 GLU GLU A . n A 1 60 GLY 60 78 78 GLY GLY A . n A 1 61 ASN 61 79 79 ASN ASN A . n A 1 62 GLU 62 80 80 GLU GLU A . n A 1 63 GLN 63 81 81 GLN GLN A . n A 1 64 PHE 64 82 82 PHE PHE A . n A 1 65 VAL 65 83 83 VAL VAL A . n A 1 66 ASN 66 84 84 ASN ASN A . n A 1 67 ALA 67 85 85 ALA ALA A . n A 1 68 ALA 68 86 86 ALA ALA A . n A 1 69 LYS 69 87 87 LYS LYS A . n A 1 70 ILE 70 88 88 ILE ILE A . n A 1 71 ILE 71 89 89 ILE ILE A . n A 1 72 LYS 72 90 90 LYS LYS A . n A 1 73 HIS 73 91 91 HIS HIS A . n A 1 74 PRO 74 92 92 PRO PRO A . n A 1 75 ASN 75 93 93 ASN ASN A . n A 1 76 PHE 76 94 94 PHE PHE A . n A 1 77 ASP 77 95 95 ASP ASP A . n A 1 78 ARG 78 96 96 ARG ARG A . n A 1 79 GLU 79 97 97 GLU GLU A . n A 1 80 THR 80 98 98 THR THR A . n A 1 81 TYR 81 99 99 TYR TYR A . n A 1 82 ASN 82 100 100 ASN ASN A . n A 1 83 ASN 83 101 101 ASN ASN A . n A 1 84 ASP 84 102 102 ASP ASP A . n A 1 85 ILE 85 103 103 ILE ILE A . n A 1 86 MET 86 104 104 MET MET A . n A 1 87 LEU 87 105 105 LEU LEU A . n A 1 88 ILE 88 106 106 ILE ILE A . n A 1 89 LYS 89 107 107 LYS LYS A . n A 1 90 LEU 90 108 108 LEU LEU A . n A 1 91 SER 91 109 109 SER SER A . n A 1 92 SER 92 110 110 SER SER A . n A 1 93 PRO 93 111 111 PRO PRO A . n A 1 94 VAL 94 112 112 VAL VAL A . n A 1 95 LYS 95 113 113 LYS LYS A . n A 1 96 LEU 96 114 114 LEU LEU A . n A 1 97 ASN 97 115 115 ASN ASN A . n A 1 98 ALA 98 116 116 ALA ALA A . n A 1 99 ARG 99 117 117 ARG ARG A . n A 1 100 VAL 100 118 118 VAL VAL A . n A 1 101 ALA 101 119 119 ALA ALA A . n A 1 102 THR 102 120 120 THR THR A . n A 1 103 VAL 103 121 121 VAL VAL A . n A 1 104 ALA 104 122 122 ALA ALA A . n A 1 105 LEU 105 123 123 LEU LEU A . n A 1 106 PRO 106 124 124 PRO PRO A . n A 1 107 SER 107 125 125 SER SER A . n A 1 108 SER 108 127 127 SER SER A . n A 1 109 CYS 109 128 128 CYS CYS A . n A 1 110 ALA 110 129 129 ALA ALA A . n A 1 111 PRO 111 130 130 PRO PRO A . n A 1 112 ALA 112 132 132 ALA ALA A . n A 1 113 GLY 113 133 133 GLY GLY A . n A 1 114 THR 114 134 134 THR THR A . n A 1 115 GLN 115 135 135 GLN GLN A . n A 1 116 CYS 116 136 136 CYS CYS A . n A 1 117 LEU 117 137 137 LEU LEU A . n A 1 118 ILE 118 138 138 ILE ILE A . n A 1 119 SER 119 139 139 SER SER A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 TRP 121 141 141 TRP TRP A . n A 1 122 GLY 122 142 142 GLY GLY A . n A 1 123 ASN 123 143 143 ASN ASN A . n A 1 124 THR 124 144 144 THR THR A . n A 1 125 LEU 125 145 145 LEU LEU A . n A 1 126 SER 126 146 146 SER SER A . n A 1 127 SER 127 147 147 SER SER A . n A 1 128 GLY 128 148 148 GLY GLY A . n A 1 129 VAL 129 149 149 VAL VAL A . n A 1 130 ASN 130 150 150 ASN ASN A . n A 1 131 GLU 131 151 151 GLU GLU A . n A 1 132 PRO 132 152 152 PRO PRO A . n A 1 133 ASP 133 153 153 ASP ASP A . n A 1 134 LEU 134 154 154 LEU LEU A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 GLN 136 156 156 GLN GLN A . n A 1 137 CYS 137 157 157 CYS CYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 ASP 139 159 159 ASP ASP A . n A 1 140 ALA 140 160 160 ALA ALA A . n A 1 141 PRO 141 161 161 PRO PRO A . n A 1 142 LEU 142 162 162 LEU LEU A . n A 1 143 LEU 143 163 163 LEU LEU A . n A 1 144 PRO 144 164 164 PRO PRO A . n A 1 145 GLN 145 165 165 GLN GLN A . n A 1 146 ALA 146 166 166 ALA ALA A . n A 1 147 ASP 147 167 167 ASP ASP A . n A 1 148 CYS 148 168 168 CYS CYS A . n A 1 149 GLU 149 169 169 GLU GLU A . n A 1 150 ALA 150 170 170 ALA ALA A . n A 1 151 SER 151 171 171 SER SER A . n A 1 152 SER 152 172 172 SER SER A . n A 1 153 SER 153 173 173 SER SER A . n A 1 154 PHE 154 174 174 PHE PHE A . n A 1 155 ILE 155 175 175 ILE ILE A . n A 1 156 ILE 156 176 176 ILE ILE A . n A 1 157 THR 157 177 177 THR THR A . n A 1 158 ASP 158 178 178 ASP ASP A . n A 1 159 ASN 159 179 179 ASN ASN A . n A 1 160 MET 160 180 180 MET MET A . n A 1 161 VAL 161 181 181 VAL VAL A . n A 1 162 CYS 162 182 182 CYS CYS A . n A 1 163 VAL 163 183 183 VAL VAL A . n A 1 164 GLY 164 184 184 GLY GLY A . n A 1 165 PHE 165 184 184 PHE PHE A A n A 1 166 LEU 166 185 185 LEU LEU A . n A 1 167 GLU 167 186 186 GLU GLU A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 GLY 169 188 188 GLY GLY A . n A 1 170 LYS 170 188 188 LYS LYS A A n A 1 171 ASP 171 189 189 ASP ASP A . n A 1 172 ALA 172 190 190 ALA ALA A . n A 1 173 CYS 173 191 191 CYS CYS A . n A 1 174 GLN 174 192 192 GLN GLN A . n A 1 175 GLY 175 193 193 GLY GLY A . n A 1 176 ASP 176 194 194 ASP ASP A . n A 1 177 SER 177 195 195 SER SER A . n A 1 178 GLY 178 196 196 GLY GLY A . n A 1 179 GLY 179 197 197 GLY GLY A . n A 1 180 PRO 180 198 198 PRO PRO A . n A 1 181 VAL 181 199 199 VAL VAL A . n A 1 182 VAL 182 200 200 VAL VAL A . n A 1 183 CYS 183 201 201 CYS CYS A . n A 1 184 ASN 184 202 202 ASN ASN A . n A 1 185 GLY 185 203 203 GLY GLY A . n A 1 186 GLU 186 204 204 GLU GLU A . n A 1 187 LEU 187 209 209 LEU LEU A . n A 1 188 GLN 188 210 210 GLN GLN A . n A 1 189 GLY 189 211 211 GLY GLY A . n A 1 190 ILE 190 212 212 ILE ILE A . n A 1 191 VAL 191 213 213 VAL VAL A . n A 1 192 SER 192 214 214 SER SER A . n A 1 193 TRP 193 215 215 TRP TRP A . n A 1 194 GLY 194 216 216 GLY GLY A . n A 1 195 TYR 195 217 217 TYR TYR A . n A 1 196 GLY 196 219 219 GLY GLY A . n A 1 197 CYS 197 220 220 CYS CYS A . n A 1 198 ALA 198 221 221 ALA ALA A . n A 1 199 LEU 199 221 221 LEU LEU A A n A 1 200 PRO 200 222 222 PRO PRO A . n A 1 201 ASP 201 223 223 ASP ASP A . n A 1 202 ASN 202 224 224 ASN ASN A . n A 1 203 PRO 203 225 225 PRO PRO A . n A 1 204 GLY 204 226 226 GLY GLY A . n A 1 205 VAL 205 227 227 VAL VAL A . n A 1 206 TYR 206 228 228 TYR TYR A . n A 1 207 THR 207 229 229 THR THR A . n A 1 208 LYS 208 230 230 LYS LYS A . n A 1 209 VAL 209 231 231 VAL VAL A . n A 1 210 CYS 210 232 232 CYS CYS A . n A 1 211 ASN 211 233 233 ASN ASN A . n A 1 212 TYR 212 234 234 TYR TYR A . n A 1 213 VAL 213 235 235 VAL VAL A . n A 1 214 ASP 214 236 236 ASP ASP A . n A 1 215 TRP 215 237 237 TRP TRP A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 GLN 217 239 239 GLN GLN A . n A 1 218 ASP 218 240 240 ASP ASP A . n A 1 219 THR 219 241 241 THR THR A . n A 1 220 ILE 220 242 242 ILE ILE A . n A 1 221 ALA 221 243 243 ALA ALA A . n A 1 222 ALA 222 244 244 ALA ALA A . n A 1 223 ASN 223 245 245 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 480 480 CA CA A . C 3 SO4 1 600 600 SO4 SO4 A . D 4 BEN 1 1 1 BEN BEN A . E 4 BEN 1 2 2 BEN BEN A . F 4 BEN 1 3 3 BEN BEN A . G 5 HOH 1 249 249 HOH HOH A . G 5 HOH 2 250 250 HOH HOH A . G 5 HOH 3 251 251 HOH HOH A . G 5 HOH 4 252 252 HOH HOH A . G 5 HOH 5 253 253 HOH HOH A . G 5 HOH 6 255 255 HOH HOH A . G 5 HOH 7 256 256 HOH HOH A . G 5 HOH 8 257 257 HOH HOH A . G 5 HOH 9 259 259 HOH HOH A . G 5 HOH 10 260 260 HOH HOH A . G 5 HOH 11 261 261 HOH HOH A . G 5 HOH 12 262 262 HOH HOH A . G 5 HOH 13 264 264 HOH HOH A . G 5 HOH 14 266 266 HOH HOH A . G 5 HOH 15 267 267 HOH HOH A . G 5 HOH 16 269 269 HOH HOH A . G 5 HOH 17 272 272 HOH HOH A . G 5 HOH 18 273 273 HOH HOH A . G 5 HOH 19 275 275 HOH HOH A . G 5 HOH 20 276 276 HOH HOH A . G 5 HOH 21 280 280 HOH HOH A . G 5 HOH 22 281 281 HOH HOH A . G 5 HOH 23 282 282 HOH HOH A . G 5 HOH 24 283 283 HOH HOH A . G 5 HOH 25 284 284 HOH HOH A . G 5 HOH 26 286 286 HOH HOH A . G 5 HOH 27 287 287 HOH HOH A . G 5 HOH 28 288 288 HOH HOH A . G 5 HOH 29 290 290 HOH HOH A . G 5 HOH 30 291 291 HOH HOH A . G 5 HOH 31 292 292 HOH HOH A . G 5 HOH 32 294 294 HOH HOH A . G 5 HOH 33 298 298 HOH HOH A . G 5 HOH 34 303 303 HOH HOH A . G 5 HOH 35 306 306 HOH HOH A . G 5 HOH 36 307 307 HOH HOH A . G 5 HOH 37 309 309 HOH HOH A . G 5 HOH 38 311 311 HOH HOH A . G 5 HOH 39 313 313 HOH HOH A . G 5 HOH 40 318 318 HOH HOH A . G 5 HOH 41 319 319 HOH HOH A . G 5 HOH 42 324 324 HOH HOH A . G 5 HOH 43 327 327 HOH HOH A . G 5 HOH 44 329 329 HOH HOH A . G 5 HOH 45 332 332 HOH HOH A . G 5 HOH 46 335 335 HOH HOH A . G 5 HOH 47 341 341 HOH HOH A . G 5 HOH 48 342 342 HOH HOH A . G 5 HOH 49 343 343 HOH HOH A . G 5 HOH 50 347 347 HOH HOH A . G 5 HOH 51 356 356 HOH HOH A . G 5 HOH 52 358 358 HOH HOH A . G 5 HOH 53 370 370 HOH HOH A . G 5 HOH 54 371 371 HOH HOH A . G 5 HOH 55 377 377 HOH HOH A . G 5 HOH 56 385 385 HOH HOH A . G 5 HOH 57 416 416 HOH HOH A . G 5 HOH 58 502 502 HOH HOH A . G 5 HOH 59 705 705 HOH HOH A . G 5 HOH 60 723 723 HOH HOH A . G 5 HOH 61 725 725 HOH HOH A . G 5 HOH 62 726 726 HOH HOH A . G 5 HOH 63 727 727 HOH HOH A . G 5 HOH 64 728 728 HOH HOH A . G 5 HOH 65 729 729 HOH HOH A . G 5 HOH 66 1002 1002 HOH HOH A . G 5 HOH 67 1003 1003 HOH HOH A . G 5 HOH 68 1004 1004 HOH HOH A . G 5 HOH 69 1005 1005 HOH HOH A . G 5 HOH 70 1006 1006 HOH HOH A . G 5 HOH 71 1007 1007 HOH HOH A . G 5 HOH 72 1008 1008 HOH HOH A . G 5 HOH 73 1010 1010 HOH HOH A . G 5 HOH 74 1011 1011 HOH HOH A . G 5 HOH 75 1013 1013 HOH HOH A . G 5 HOH 76 1015 1015 HOH HOH A . G 5 HOH 77 1018 1018 HOH HOH A . G 5 HOH 78 1019 1019 HOH HOH A . G 5 HOH 79 1020 1020 HOH HOH A . G 5 HOH 80 1021 1021 HOH HOH A . G 5 HOH 81 1022 1022 HOH HOH A . G 5 HOH 82 1023 1023 HOH HOH A . G 5 HOH 83 1024 1024 HOH HOH A . G 5 HOH 84 1025 1025 HOH HOH A . G 5 HOH 85 1027 1027 HOH HOH A . G 5 HOH 86 1031 1031 HOH HOH A . G 5 HOH 87 1032 1032 HOH HOH A . G 5 HOH 88 1033 1033 HOH HOH A . G 5 HOH 89 1038 1038 HOH HOH A . G 5 HOH 90 1039 1039 HOH HOH A . G 5 HOH 91 1043 1043 HOH HOH A . G 5 HOH 92 1044 1044 HOH HOH A . G 5 HOH 93 1046 1046 HOH HOH A . G 5 HOH 94 1047 1047 HOH HOH A . G 5 HOH 95 1049 1049 HOH HOH A . G 5 HOH 96 1051 1051 HOH HOH A . G 5 HOH 97 1053 1053 HOH HOH A . G 5 HOH 98 1058 1058 HOH HOH A . G 5 HOH 99 1060 1060 HOH HOH A . G 5 HOH 100 1063 1063 HOH HOH A . G 5 HOH 101 1064 1064 HOH HOH A . G 5 HOH 102 1070 1070 HOH HOH A . G 5 HOH 103 1071 1071 HOH HOH A . G 5 HOH 104 1073 1073 HOH HOH A . G 5 HOH 105 1074 1074 HOH HOH A . G 5 HOH 106 1076 1076 HOH HOH A . G 5 HOH 107 1077 1077 HOH HOH A . G 5 HOH 108 1078 1078 HOH HOH A . G 5 HOH 109 1081 1081 HOH HOH A . G 5 HOH 110 1084 1084 HOH HOH A . G 5 HOH 111 1086 1086 HOH HOH A . G 5 HOH 112 1089 1089 HOH HOH A . G 5 HOH 113 1091 1091 HOH HOH A . G 5 HOH 114 1096 1096 HOH HOH A . G 5 HOH 115 1099 1099 HOH HOH A . G 5 HOH 116 1100 1100 HOH HOH A . G 5 HOH 117 1103 1103 HOH HOH A . G 5 HOH 118 1104 1104 HOH HOH A . G 5 HOH 119 1105 1105 HOH HOH A . G 5 HOH 120 1108 1108 HOH HOH A . G 5 HOH 121 1109 1109 HOH HOH A . G 5 HOH 122 1110 1110 HOH HOH A . G 5 HOH 123 1115 1115 HOH HOH A . G 5 HOH 124 1117 1117 HOH HOH A . G 5 HOH 125 1118 1118 HOH HOH A . G 5 HOH 126 1124 1124 HOH HOH A . G 5 HOH 127 1126 1126 HOH HOH A . G 5 HOH 128 1146 1146 HOH HOH A . G 5 HOH 129 1148 1148 HOH HOH A . G 5 HOH 130 1150 1150 HOH HOH A . G 5 HOH 131 1153 1153 HOH HOH A . G 5 HOH 132 1177 1177 HOH HOH A . G 5 HOH 133 1180 1180 HOH HOH A . G 5 HOH 134 1183 1183 HOH HOH A . G 5 HOH 135 1191 1191 HOH HOH A . G 5 HOH 136 1201 1201 HOH HOH A . G 5 HOH 137 1221 1221 HOH HOH A . G 5 HOH 138 2002 2002 HOH HOH A . G 5 HOH 139 2008 2008 HOH HOH A . G 5 HOH 140 2013 2013 HOH HOH A . G 5 HOH 141 2021 2021 HOH HOH A . G 5 HOH 142 2053 2053 HOH HOH A . G 5 HOH 143 2073 2073 HOH HOH A . G 5 HOH 144 2078 2078 HOH HOH A . G 5 HOH 145 2087 2087 HOH HOH A . G 5 HOH 146 2132 2132 HOH HOH A . G 5 HOH 147 2208 2208 HOH HOH A . G 5 HOH 148 2210 2210 HOH HOH A . G 5 HOH 149 2211 2211 HOH HOH A . G 5 HOH 150 2213 2213 HOH HOH A . G 5 HOH 151 2222 2222 HOH HOH A . G 5 HOH 152 2223 2223 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A BEN 2 ? E BEN . 2 1 A BEN 2 ? E BEN . 3 1 A BEN 2 ? E BEN . 4 1 A BEN 3 ? F BEN . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 86.9 ? 2 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 169.8 ? 3 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 84.6 ? 4 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 91.1 ? 5 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 82.6 ? 6 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 93.5 ? 7 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 97.5 ? 8 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 164.9 ? 9 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 92.2 ? 10 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 82.9 ? 11 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? G HOH . ? A HOH 261 ? 1_555 82.3 ? 12 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? G HOH . ? A HOH 261 ? 1_555 101.9 ? 13 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? G HOH . ? A HOH 261 ? 1_555 93.8 ? 14 OE1 ? A GLU 59 ? A GLU 77 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? G HOH . ? A HOH 261 ? 1_555 171.8 ? 15 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? G HOH . ? A HOH 261 ? 1_555 93.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-12-23 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' pdbx_struct_special_symmetry 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 X-PLOR refinement . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 49 ? ? -59.75 -8.40 2 1 HIS A 71 ? ? -130.62 -66.68 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ARG 96 ? CD ? A ARG 78 CD 2 1 Y 0 A ARG 96 ? NE ? A ARG 78 NE 3 1 Y 0 A ARG 96 ? CZ ? A ARG 78 CZ 4 1 Y 0 A ARG 96 ? NH1 ? A ARG 78 NH1 5 1 Y 0 A ARG 96 ? NH2 ? A ARG 78 NH2 6 1 Y 0 A LYS 113 ? CD ? A LYS 95 CD 7 1 Y 0 A LYS 113 ? CE ? A LYS 95 CE 8 1 Y 0 A LYS 113 ? NZ ? A LYS 95 NZ 9 1 Y 0 A GLN 165 ? CG ? A GLN 145 CG 10 1 Y 0 A GLN 165 ? CD ? A GLN 145 CD 11 1 Y 0 A GLN 165 ? OE1 ? A GLN 145 OE1 12 1 Y 0 A GLN 165 ? NE2 ? A GLN 145 NE2 13 1 Y 0 A ASP 178 ? CG ? A ASP 158 CG 14 1 Y 0 A ASP 178 ? OD1 ? A ASP 158 OD1 15 1 Y 0 A ASP 178 ? OD2 ? A ASP 158 OD2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'SULFATE ION' SO4 4 BENZAMIDINE BEN 5 water HOH #