data_1J5C # _entry.id 1J5C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1J5C pdb_00001j5c 10.2210/pdb1j5c/pdb RCSB RCSB001631 ? ? WWPDB D_1000001631 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-04-10 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.pdb_id 1J5C _pdbx_database_PDB_obs_spr.replace_pdb_id 1I0W _pdbx_database_PDB_obs_spr.date 2002-04-10 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1J5C _pdbx_database_status.recvd_initial_deposition_date 2002-04-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1J5D _pdbx_database_related.details 'SOLUTION STRUCTURE OF OXIDIZED PARAMAGNETIC CU(II) PLASTOCYANIN FROM SYNECHOCYSTIS PCC6803-MINIMIZED AVERAGE STRUCTURE' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bertini, I.' 1 'Ciurli, S.' 2 'Dikiy, A.' 3 'Fernandez, C.O.' 4 'Luchinat, C.' 5 'Safarov, N.' 6 'Shumilin, S.' 7 'Vila, A.J.' 8 # _citation.id primary _citation.title ;The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803. ; _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 123 _citation.page_first 2405 _citation.page_last 2413 _citation.year 2001 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11456890 _citation.pdbx_database_id_DOI 10.1021/ja0033685 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bertini, I.' 1 ? primary 'Ciurli, S.' 2 ? primary 'Dikiy, A.' 3 ? primary 'Fernandez, C.O.' 4 ? primary 'Luchinat, C.' 5 ? primary 'Safarov, N.' 6 ? primary 'Shumilin, S.' 7 ? primary 'Vila, A.J.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man PLASTOCYANIN 10249.430 1 ? D98E ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYT YYCEPHRGAGMVGKVVVD ; _entity_poly.pdbx_seq_one_letter_code_can ;ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYT YYCEPHRGAGMVGKVVVD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (II) ION' _pdbx_entity_nonpoly.comp_id CU # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASN n 1 3 ALA n 1 4 THR n 1 5 VAL n 1 6 LYS n 1 7 MET n 1 8 GLY n 1 9 SER n 1 10 ASP n 1 11 SER n 1 12 GLY n 1 13 ALA n 1 14 LEU n 1 15 VAL n 1 16 PHE n 1 17 GLU n 1 18 PRO n 1 19 SER n 1 20 THR n 1 21 VAL n 1 22 THR n 1 23 ILE n 1 24 LYS n 1 25 ALA n 1 26 GLY n 1 27 GLU n 1 28 GLU n 1 29 VAL n 1 30 LYS n 1 31 TRP n 1 32 VAL n 1 33 ASN n 1 34 ASN n 1 35 LYS n 1 36 LEU n 1 37 SER n 1 38 PRO n 1 39 HIS n 1 40 ASN n 1 41 ILE n 1 42 VAL n 1 43 PHE n 1 44 ALA n 1 45 ALA n 1 46 ASP n 1 47 GLY n 1 48 VAL n 1 49 ASP n 1 50 ALA n 1 51 ASP n 1 52 THR n 1 53 ALA n 1 54 ALA n 1 55 LYS n 1 56 LEU n 1 57 SER n 1 58 HIS n 1 59 LYS n 1 60 GLY n 1 61 LEU n 1 62 ALA n 1 63 PHE n 1 64 ALA n 1 65 ALA n 1 66 GLY n 1 67 GLU n 1 68 SER n 1 69 PHE n 1 70 THR n 1 71 SER n 1 72 THR n 1 73 PHE n 1 74 THR n 1 75 GLU n 1 76 PRO n 1 77 GLY n 1 78 THR n 1 79 TYR n 1 80 THR n 1 81 TYR n 1 82 TYR n 1 83 CYS n 1 84 GLU n 1 85 PRO n 1 86 HIS n 1 87 ARG n 1 88 GLY n 1 89 ALA n 1 90 GLY n 1 91 MET n 1 92 VAL n 1 93 GLY n 1 94 LYS n 1 95 VAL n 1 96 VAL n 1 97 VAL n 1 98 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Synechocystis _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain PCC6803 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechocystis sp. PCC 6803' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1148 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BLR(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ASP 98 98 98 ASP ASP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 99 _pdbx_nonpoly_scheme.auth_seq_num 99 _pdbx_nonpoly_scheme.pdb_mon_id CU _pdbx_nonpoly_scheme.auth_mon_id CU _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1J5C _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1J5C _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1J5C _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1J5C _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1J5C _struct.title 'SOLUTION STRUCTURE OF OXIDIZED PARAMAGNETIC CU(II) PLASTOCYANIN FROM SYNECHOCYSTIS PCC6803' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1J5C _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'copper protein beta barrel electron transfer, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PLAS_SYNY3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYT YYCEPHRGAGMVGKVVVE ; _struct_ref.pdbx_align_begin 29 _struct_ref.pdbx_db_accession P21697 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1J5C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21697 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 98 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1J5C _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 98 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P21697 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 126 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 98 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 49 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 57 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 49 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 57 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 39 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 39 A CU 99 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc2 metalc ? ? A CYS 83 SG ? ? ? 1_555 B CU . CU ? ? A CYS 83 A CU 99 1_555 ? ? ? ? ? ? ? 2.417 ? ? metalc3 metalc ? ? A HIS 86 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 86 A CU 99 1_555 ? ? ? ? ? ? ? 2.308 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 CU ? B CU . ? A CU 99 ? 1_555 SG ? A CYS 83 ? A CYS 83 ? 1_555 96.9 ? 2 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 CU ? B CU . ? A CU 99 ? 1_555 ND1 ? A HIS 86 ? A HIS 86 ? 1_555 112.5 ? 3 SG ? A CYS 83 ? A CYS 83 ? 1_555 CU ? B CU . ? A CU 99 ? 1_555 ND1 ? A HIS 86 ? A HIS 86 ? 1_555 79.2 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 1 0.09 2 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 1 0.00 3 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 2 0.17 4 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 2 0.02 5 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 3 -0.03 6 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 3 0.04 7 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 4 0.01 8 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 4 0.01 9 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 5 0.02 10 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 5 0.03 11 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 6 -0.02 12 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 6 0.11 13 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 7 0.01 14 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 7 0.13 15 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 8 0.00 16 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 8 0.12 17 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 9 -0.14 18 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 9 0.07 19 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 10 0.06 20 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 10 -0.05 21 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 11 0.03 22 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 11 -0.01 23 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 12 0.03 24 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 12 0.08 25 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 13 0.01 26 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 13 0.05 27 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 14 0.01 28 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 14 0.08 29 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 15 -0.04 30 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 15 0.08 31 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 16 -0.08 32 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 16 -0.11 33 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 17 -0.01 34 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 17 -0.07 35 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 18 -0.01 36 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 18 -0.07 37 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 19 -0.03 38 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 19 0.10 39 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 20 -0.05 40 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 20 -0.04 41 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 21 -0.05 42 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 21 0.01 43 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 22 -0.01 44 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 22 0.04 45 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 23 0.03 46 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 23 -0.06 47 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 24 0.10 48 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 24 0.07 49 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 25 -0.06 50 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 25 0.03 51 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 26 -0.03 52 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 26 -0.07 53 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 27 0.01 54 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 27 0.06 55 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 28 0.09 56 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 28 -0.15 57 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 29 -0.07 58 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 29 0.15 59 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 30 0.04 60 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 30 -0.09 61 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 31 0.09 62 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 31 0.08 63 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 32 0.04 64 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 32 -0.01 65 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 33 0.03 66 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 33 -0.02 67 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 34 -0.01 68 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 34 -0.01 69 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 35 -0.06 70 SER 37 A . ? SER 37 A PRO 38 A ? PRO 38 A 35 -0.16 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 3 ? THR A 4 ? ALA A 3 THR A 4 A 2 GLU A 28 ? TRP A 31 ? GLU A 28 TRP A 31 A 3 PHE A 69 ? THR A 72 ? PHE A 69 THR A 72 B 1 THR A 20 ? LYS A 24 ? THR A 20 LYS A 24 B 2 LYS A 94 ? ASP A 98 ? LYS A 94 ASP A 98 C 1 PHE A 43 ? ALA A 44 ? PHE A 43 ALA A 44 C 2 THR A 80 ? TYR A 81 ? THR A 80 TYR A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 3 ? N ALA A 3 O GLU A 28 ? O GLU A 28 A 2 3 N TRP A 31 ? N TRP A 31 O PHE A 69 ? O PHE A 69 B 1 2 N VAL A 21 ? N VAL A 21 O LYS A 94 ? O LYS A 94 C 1 2 N ALA A 44 ? N ALA A 44 O THR A 80 ? O THR A 80 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CU _struct_site.pdbx_auth_seq_id 99 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE CU A 99' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 PHE A 16 ? PHE A 16 . ? 1_555 ? 2 AC1 5 HIS A 39 ? HIS A 39 . ? 1_555 ? 3 AC1 5 CYS A 83 ? CYS A 83 . ? 1_555 ? 4 AC1 5 HIS A 86 ? HIS A 86 . ? 1_555 ? 5 AC1 5 MET A 91 ? MET A 91 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE3 A MET 91 ? ? CU A CU 99 ? ? 0.85 2 1 CE A MET 91 ? ? CU A CU 99 ? ? 1.57 3 2 HG1 A THR 4 ? ? O A LYS 30 ? ? 1.53 4 3 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.29 5 3 HB2 A HIS 39 ? ? CU A CU 99 ? ? 1.41 6 6 HE3 A MET 91 ? ? CU A CU 99 ? ? 1.49 7 6 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.53 8 7 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.41 9 7 O A HIS 39 ? ? H A ALA 62 ? ? 1.58 10 8 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.45 11 9 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.24 12 10 HG1 A THR 4 ? ? O A LYS 30 ? ? 1.53 13 10 O A ILE 23 ? ? H A ASP 98 ? ? 1.54 14 11 O A ALA 54 ? ? HG A SER 57 ? ? 1.49 15 12 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.11 16 13 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.22 17 13 HG1 A THR 4 ? ? O A LYS 30 ? ? 1.45 18 13 O A ILE 23 ? ? H A ASP 98 ? ? 1.59 19 14 HE3 A MET 91 ? ? CU A CU 99 ? ? 1.15 20 14 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.22 21 14 CE1 A HIS 86 ? ? CU A CU 99 ? ? 1.60 22 15 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.33 23 21 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.09 24 21 HG1 A THR 4 ? ? O A LYS 30 ? ? 1.50 25 22 HB2 A HIS 39 ? ? CU A CU 99 ? ? 1.56 26 23 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.47 27 23 O A ILE 23 ? ? H A ASP 98 ? ? 1.58 28 24 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.07 29 24 CE1 A HIS 86 ? ? CU A CU 99 ? ? 1.40 30 24 O A ILE 23 ? ? H A ASP 98 ? ? 1.52 31 24 H A ILE 23 ? ? O A VAL 96 ? ? 1.54 32 24 O A GLY 8 ? ? HD21 A ASN 34 ? ? 1.56 33 25 HE2 A MET 91 ? ? CU A CU 99 ? ? 0.87 34 25 O A GLU 27 ? ? H A PHE 73 ? ? 1.60 35 26 HB2 A HIS 39 ? ? CU A CU 99 ? ? 0.89 36 26 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.45 37 27 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.43 38 28 HE1 A HIS 86 ? ? CU A CU 99 ? ? 0.90 39 28 O A HIS 39 ? ? H A ALA 62 ? ? 1.57 40 29 HE1 A HIS 86 ? ? CU A CU 99 ? ? 0.65 41 29 HG1 A THR 4 ? ? O A LYS 30 ? ? 1.44 42 29 CE1 A HIS 86 ? ? CU A CU 99 ? ? 1.45 43 30 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.46 44 32 CE1 A HIS 39 ? ? CU A CU 99 ? ? 1.47 45 32 HE1 A HIS 39 ? ? CU A CU 99 ? ? 1.48 46 32 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.50 47 33 HE1 A HIS 86 ? ? CU A CU 99 ? ? 1.37 48 35 HG1 A THR 4 ? ? O A LYS 30 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 14 ? ? -98.25 -63.05 2 1 LYS A 35 ? ? -177.40 -164.70 3 1 LEU A 36 ? ? 65.56 70.28 4 1 ALA A 45 ? ? -111.35 79.12 5 1 ASP A 46 ? ? -95.98 -73.14 6 1 LYS A 59 ? ? -97.36 36.37 7 1 LEU A 61 ? ? -175.35 107.38 8 1 PHE A 63 ? ? -123.15 -55.58 9 1 PRO A 85 ? ? -75.00 -88.81 10 1 HIS A 86 ? ? 52.09 -164.62 11 1 ARG A 87 ? ? -160.86 55.16 12 2 LYS A 35 ? ? -174.96 -166.54 13 2 LEU A 36 ? ? 65.74 61.01 14 2 ASP A 46 ? ? -99.42 -65.47 15 2 ASP A 49 ? ? -68.23 -179.38 16 2 PHE A 63 ? ? -141.41 -60.41 17 2 ARG A 87 ? ? -119.83 79.77 18 2 ALA A 89 ? ? 172.94 88.49 19 2 MET A 91 ? ? 58.85 90.75 20 2 VAL A 92 ? ? -137.80 -58.22 21 3 LEU A 36 ? ? 63.93 68.76 22 3 HIS A 39 ? ? -176.60 132.20 23 3 ALA A 45 ? ? -107.25 79.90 24 3 ASP A 46 ? ? -95.99 -74.04 25 3 ALA A 50 ? ? -73.77 -70.10 26 3 LEU A 61 ? ? -172.97 34.49 27 3 PHE A 63 ? ? -158.61 -49.38 28 3 PRO A 85 ? ? -74.96 -86.31 29 3 HIS A 86 ? ? 66.15 -167.65 30 3 ALA A 89 ? ? -145.09 -76.67 31 4 SER A 11 ? ? -88.40 42.42 32 4 LYS A 35 ? ? -174.78 -166.97 33 4 LEU A 36 ? ? 64.34 70.30 34 4 HIS A 39 ? ? 60.48 145.70 35 4 ALA A 45 ? ? -111.78 78.31 36 4 ASP A 46 ? ? -92.48 -68.26 37 4 ASP A 49 ? ? -58.99 174.97 38 4 ALA A 50 ? ? -80.07 -70.28 39 4 PHE A 63 ? ? -144.32 -47.36 40 4 ALA A 89 ? ? -125.39 -55.92 41 4 VAL A 92 ? ? -151.21 -76.68 42 5 LEU A 14 ? ? -91.97 53.52 43 5 LEU A 36 ? ? 65.55 68.33 44 5 PRO A 38 ? ? -74.97 -169.01 45 5 ALA A 45 ? ? -118.59 73.49 46 5 ASP A 46 ? ? -92.00 -83.87 47 5 LEU A 61 ? ? -171.74 38.09 48 5 PHE A 63 ? ? -156.13 -47.26 49 5 ALA A 65 ? ? -47.10 101.41 50 5 CYS A 83 ? ? -108.11 61.85 51 5 HIS A 86 ? ? -152.41 -66.96 52 5 ARG A 87 ? ? 175.40 169.41 53 5 VAL A 92 ? ? -75.25 -91.58 54 6 LYS A 35 ? ? -169.75 -166.40 55 6 SER A 37 ? ? -40.98 162.45 56 6 HIS A 39 ? ? 67.11 115.84 57 6 ALA A 45 ? ? -110.81 78.72 58 6 ASP A 46 ? ? -101.84 -69.84 59 6 PHE A 63 ? ? -127.31 -64.57 60 6 HIS A 86 ? ? 85.35 48.83 61 6 ARG A 87 ? ? 61.60 -80.03 62 6 ALA A 89 ? ? 67.25 63.59 63 7 ASN A 34 ? ? -108.55 -69.31 64 7 LYS A 35 ? ? -171.98 -175.70 65 7 LEU A 36 ? ? 65.60 70.03 66 7 ILE A 41 ? ? -117.01 72.49 67 7 ALA A 45 ? ? -107.94 77.23 68 7 ASP A 46 ? ? -95.72 -80.19 69 7 LYS A 59 ? ? -97.98 36.37 70 7 PHE A 63 ? ? -143.86 -45.08 71 7 HIS A 86 ? ? -39.91 -73.10 72 7 ARG A 87 ? ? 49.08 92.72 73 7 ALA A 89 ? ? -155.90 36.98 74 7 MET A 91 ? ? 174.50 123.54 75 7 VAL A 92 ? ? -174.98 -92.64 76 8 ASN A 34 ? ? -106.33 -66.63 77 8 LYS A 35 ? ? -166.30 -167.43 78 8 LEU A 36 ? ? 68.80 70.31 79 8 HIS A 39 ? ? -179.01 147.43 80 8 ASP A 46 ? ? -91.48 -79.06 81 8 PHE A 63 ? ? -143.67 -58.06 82 8 CYS A 83 ? ? -43.15 108.49 83 8 HIS A 86 ? ? -132.68 -60.16 84 8 ARG A 87 ? ? 59.43 111.77 85 8 ALA A 89 ? ? -154.36 75.54 86 8 MET A 91 ? ? -38.23 125.55 87 8 VAL A 92 ? ? -83.04 -149.60 88 9 LEU A 14 ? ? -91.85 -66.31 89 9 ASN A 34 ? ? -100.70 -67.53 90 9 LEU A 36 ? ? 61.86 62.61 91 9 ALA A 45 ? ? -102.14 78.18 92 9 LEU A 61 ? ? 75.20 41.31 93 9 PHE A 63 ? ? -139.59 -44.75 94 9 CYS A 83 ? ? -108.30 45.77 95 9 GLU A 84 ? ? 52.58 173.59 96 9 ARG A 87 ? ? 71.51 -58.96 97 9 ALA A 89 ? ? -139.16 -46.87 98 9 MET A 91 ? ? -43.16 150.29 99 9 VAL A 92 ? ? -102.56 -165.22 100 10 MET A 7 ? ? -67.99 96.38 101 10 LEU A 14 ? ? -93.86 -61.32 102 10 LEU A 36 ? ? 61.47 66.63 103 10 PRO A 38 ? ? -74.95 -166.94 104 10 ILE A 41 ? ? -100.10 77.60 105 10 ALA A 45 ? ? -112.12 76.75 106 10 ASP A 46 ? ? -92.91 -80.76 107 10 LYS A 59 ? ? -93.48 35.67 108 10 GLU A 84 ? ? -171.50 -61.12 109 10 HIS A 86 ? ? -156.37 46.44 110 10 ALA A 89 ? ? -160.54 -44.76 111 10 MET A 91 ? ? -176.95 57.32 112 11 SER A 11 ? ? -100.83 45.21 113 11 VAL A 15 ? ? 50.16 -179.95 114 11 ASN A 34 ? ? -79.01 -76.54 115 11 LEU A 36 ? ? 79.99 63.24 116 11 ASP A 46 ? ? -99.41 -69.57 117 11 LEU A 61 ? ? 79.44 41.08 118 11 PHE A 63 ? ? -121.49 -56.64 119 11 HIS A 86 ? ? 48.38 -175.38 120 11 ARG A 87 ? ? -143.41 39.46 121 11 ALA A 89 ? ? -133.00 -80.46 122 12 MET A 7 ? ? -57.47 90.86 123 12 SER A 11 ? ? -57.07 -162.30 124 12 ALA A 13 ? ? 68.10 118.99 125 12 LEU A 14 ? ? -145.10 -61.20 126 12 VAL A 15 ? ? -70.02 -157.32 127 12 ALA A 25 ? ? -66.18 96.21 128 12 LEU A 36 ? ? 79.37 49.27 129 12 PRO A 38 ? ? -75.06 -167.34 130 12 HIS A 39 ? ? -161.27 112.27 131 12 LEU A 61 ? ? 67.96 124.75 132 12 PHE A 63 ? ? -158.78 -44.91 133 12 ALA A 65 ? ? -49.36 94.91 134 12 PRO A 85 ? ? -75.02 -162.57 135 12 HIS A 86 ? ? 71.33 -73.18 136 12 ARG A 87 ? ? 39.53 91.79 137 12 ALA A 89 ? ? -124.71 -51.25 138 12 VAL A 92 ? ? -132.17 -56.82 139 13 SER A 11 ? ? 172.23 89.20 140 13 LYS A 35 ? ? -174.86 -172.96 141 13 LEU A 36 ? ? 66.21 69.85 142 13 PRO A 38 ? ? -75.03 -168.72 143 13 LEU A 61 ? ? 87.32 39.15 144 13 PHE A 63 ? ? -94.17 -63.65 145 13 TYR A 82 ? ? -99.75 -150.56 146 13 CYS A 83 ? ? -163.53 37.48 147 13 GLU A 84 ? ? 54.48 167.90 148 13 ARG A 87 ? ? 62.55 63.69 149 13 ALA A 89 ? ? 168.13 -75.03 150 13 MET A 91 ? ? -170.44 133.14 151 13 VAL A 92 ? ? -152.56 -83.88 152 14 ASN A 34 ? ? -99.17 -80.77 153 14 LEU A 36 ? ? 66.05 67.11 154 14 HIS A 39 ? ? -161.13 95.62 155 14 ILE A 41 ? ? -118.50 71.30 156 14 LEU A 61 ? ? 65.07 118.60 157 14 PHE A 63 ? ? -164.14 -42.22 158 14 PRO A 85 ? ? -74.99 -90.90 159 14 HIS A 86 ? ? 50.00 -173.01 160 14 ARG A 87 ? ? -158.78 -42.67 161 14 ALA A 89 ? ? -148.52 39.34 162 15 MET A 7 ? ? -63.10 92.68 163 15 LEU A 14 ? ? -104.66 53.24 164 15 LYS A 35 ? ? -161.46 -169.22 165 15 LEU A 36 ? ? 64.29 70.20 166 15 PRO A 38 ? ? -75.04 -166.45 167 15 LYS A 59 ? ? -97.32 34.79 168 15 LEU A 61 ? ? 179.39 122.61 169 15 PHE A 63 ? ? -144.71 -45.28 170 15 CYS A 83 ? ? -42.48 103.70 171 15 PRO A 85 ? ? -75.02 -164.07 172 15 HIS A 86 ? ? 66.01 -74.99 173 15 ARG A 87 ? ? 66.74 -70.59 174 16 MET A 7 ? ? -64.66 90.70 175 16 LEU A 14 ? ? -75.13 -163.33 176 16 VAL A 15 ? ? 50.93 177.56 177 16 ASN A 34 ? ? -85.23 -71.15 178 16 LYS A 35 ? ? -167.20 -157.65 179 16 ASP A 46 ? ? -95.72 -71.48 180 16 PHE A 63 ? ? -154.74 -46.35 181 16 CYS A 83 ? ? -44.56 102.08 182 16 ALA A 89 ? ? 164.05 100.77 183 16 MET A 91 ? ? 50.82 101.18 184 17 MET A 7 ? ? 37.20 -94.37 185 17 VAL A 15 ? ? -160.85 -163.50 186 17 ASN A 34 ? ? -121.12 -68.93 187 17 LEU A 36 ? ? 60.98 69.94 188 17 LYS A 59 ? ? -96.10 37.85 189 17 LEU A 61 ? ? -172.79 124.78 190 17 PHE A 63 ? ? -131.24 -58.46 191 17 ALA A 65 ? ? -68.73 90.07 192 17 HIS A 86 ? ? -144.15 36.46 193 17 ALA A 89 ? ? -125.40 -55.43 194 17 MET A 91 ? ? 44.05 92.81 195 17 VAL A 92 ? ? -99.63 -95.94 196 18 MET A 7 ? ? -44.97 -73.17 197 18 SER A 11 ? ? -88.72 40.94 198 18 ASN A 34 ? ? -90.58 -62.63 199 18 LEU A 36 ? ? 67.44 68.19 200 18 PRO A 38 ? ? -74.94 -165.35 201 18 ILE A 41 ? ? -109.88 69.95 202 18 ASP A 46 ? ? -100.33 -65.87 203 18 ALA A 65 ? ? -47.91 168.74 204 18 HIS A 86 ? ? -33.86 123.92 205 18 ALA A 89 ? ? -61.28 -93.68 206 18 MET A 91 ? ? 57.20 161.06 207 19 ALA A 25 ? ? -61.34 99.09 208 19 ASN A 34 ? ? -91.70 -77.23 209 19 LEU A 36 ? ? 72.52 70.30 210 19 PRO A 38 ? ? -75.07 -169.57 211 19 ILE A 41 ? ? -119.10 65.66 212 19 LYS A 59 ? ? -99.05 40.87 213 19 LEU A 61 ? ? -176.94 130.63 214 19 PHE A 63 ? ? -160.10 -44.95 215 19 ALA A 65 ? ? -58.71 91.32 216 19 HIS A 86 ? ? -172.37 62.39 217 19 ARG A 87 ? ? 45.42 84.80 218 19 ALA A 89 ? ? -118.25 -70.39 219 19 VAL A 92 ? ? -132.16 -93.36 220 20 ASN A 34 ? ? -107.52 -68.25 221 20 LYS A 35 ? ? -172.13 -173.18 222 20 LEU A 36 ? ? 67.40 62.89 223 20 PRO A 38 ? ? -75.05 -168.09 224 20 LEU A 61 ? ? -179.99 41.72 225 20 PHE A 63 ? ? -122.52 -64.26 226 20 TYR A 82 ? ? -170.53 -173.83 227 20 ARG A 87 ? ? -39.13 107.58 228 20 ALA A 89 ? ? -128.68 -56.61 229 21 MET A 7 ? ? -69.28 77.19 230 21 ALA A 25 ? ? -68.78 99.87 231 21 LEU A 36 ? ? 67.66 69.73 232 21 HIS A 39 ? ? -150.45 79.04 233 21 ASP A 46 ? ? -101.74 -72.97 234 21 LEU A 61 ? ? 63.79 122.38 235 21 PHE A 63 ? ? -158.76 -47.01 236 21 ALA A 89 ? ? -142.66 -78.98 237 22 MET A 7 ? ? 64.72 -70.95 238 22 LYS A 35 ? ? -175.98 -156.25 239 22 LEU A 36 ? ? 57.77 70.23 240 22 HIS A 39 ? ? -178.63 140.82 241 22 ALA A 45 ? ? -101.38 79.16 242 22 LEU A 61 ? ? 82.87 30.15 243 22 PHE A 63 ? ? -164.02 -41.68 244 22 HIS A 86 ? ? -167.94 56.12 245 22 ARG A 87 ? ? 83.72 -60.23 246 22 ALA A 89 ? ? -165.76 -44.22 247 22 VAL A 92 ? ? -141.26 -153.02 248 23 LYS A 35 ? ? 172.51 -163.89 249 23 PRO A 38 ? ? -74.93 -166.54 250 23 ILE A 41 ? ? -119.21 71.51 251 23 ASP A 46 ? ? -98.10 -68.36 252 23 LEU A 61 ? ? -164.37 119.34 253 23 PHE A 63 ? ? -141.81 -46.58 254 23 VAL A 92 ? ? -149.54 -81.75 255 24 LYS A 6 ? ? -69.92 86.00 256 24 MET A 7 ? ? -60.47 83.52 257 24 LEU A 36 ? ? 68.04 70.40 258 24 ALA A 45 ? ? -112.85 76.75 259 24 ASP A 46 ? ? -96.56 -78.92 260 24 LEU A 61 ? ? 73.84 109.01 261 24 PHE A 63 ? ? -155.87 -43.82 262 24 ALA A 65 ? ? -48.76 167.18 263 24 HIS A 86 ? ? -146.24 47.36 264 24 MET A 91 ? ? 36.11 89.58 265 25 LYS A 6 ? ? -58.65 103.82 266 25 MET A 7 ? ? -57.71 89.81 267 25 SER A 11 ? ? -51.79 -95.99 268 25 ALA A 13 ? ? 73.49 85.07 269 25 LEU A 14 ? ? -125.66 -58.74 270 25 LEU A 36 ? ? 64.95 70.20 271 25 PRO A 38 ? ? -74.94 -167.96 272 25 LEU A 61 ? ? 74.24 118.97 273 25 HIS A 86 ? ? -133.84 -49.02 274 25 ARG A 87 ? ? 158.43 157.22 275 26 LYS A 6 ? ? -85.50 49.79 276 26 MET A 7 ? ? 35.13 -95.32 277 26 SER A 11 ? ? -86.66 46.23 278 26 VAL A 15 ? ? -39.86 142.40 279 26 LYS A 35 ? ? -177.25 -149.86 280 26 HIS A 39 ? ? 179.21 -177.85 281 26 ASN A 40 ? ? -173.20 -177.06 282 26 LEU A 61 ? ? 69.77 141.70 283 26 PHE A 63 ? ? -160.68 -51.06 284 26 ALA A 65 ? ? -69.05 95.31 285 26 GLU A 84 ? ? -43.28 166.73 286 26 HIS A 86 ? ? -38.62 -88.93 287 26 ARG A 87 ? ? -100.81 -68.80 288 26 ALA A 89 ? ? -160.76 -57.03 289 26 MET A 91 ? ? 176.37 90.97 290 27 LYS A 35 ? ? -177.40 -170.81 291 27 LEU A 36 ? ? 65.72 70.01 292 27 PRO A 38 ? ? -74.96 -167.35 293 27 HIS A 39 ? ? -170.73 111.43 294 27 ALA A 45 ? ? -101.99 79.61 295 27 ASP A 46 ? ? -100.14 -65.86 296 27 LYS A 59 ? ? -98.00 40.58 297 27 LEU A 61 ? ? -174.62 118.09 298 27 PHE A 63 ? ? -162.98 -42.82 299 27 ALA A 65 ? ? -51.51 105.41 300 27 TYR A 82 ? ? -165.45 -169.92 301 27 HIS A 86 ? ? 56.92 108.92 302 27 ALA A 89 ? ? 170.66 101.92 303 27 VAL A 92 ? ? 63.29 -103.15 304 28 ASN A 34 ? ? -91.95 -66.70 305 28 LEU A 36 ? ? 63.45 69.57 306 28 ALA A 45 ? ? -102.60 75.16 307 28 PHE A 63 ? ? -124.28 -56.61 308 28 TYR A 82 ? ? -125.95 -148.88 309 28 CYS A 83 ? ? -151.03 36.98 310 28 GLU A 84 ? ? 56.94 161.10 311 28 ARG A 87 ? ? -43.84 102.05 312 28 ALA A 89 ? ? 165.01 -38.47 313 28 MET A 91 ? ? 179.84 66.86 314 29 MET A 7 ? ? -61.20 -85.85 315 29 LEU A 14 ? ? -105.96 52.88 316 29 LEU A 36 ? ? 67.44 65.34 317 29 ASN A 40 ? ? -167.41 103.12 318 29 ALA A 45 ? ? -111.01 75.50 319 29 ASP A 46 ? ? -97.91 -75.41 320 29 PHE A 63 ? ? -133.94 -45.10 321 29 ALA A 65 ? ? -64.06 82.17 322 29 TYR A 82 ? ? -170.56 127.58 323 29 HIS A 86 ? ? 48.63 -168.28 324 29 ARG A 87 ? ? -151.22 50.59 325 29 ALA A 89 ? ? 175.33 100.31 326 29 MET A 91 ? ? -141.26 -49.71 327 29 VAL A 92 ? ? 76.64 -172.10 328 30 MET A 7 ? ? -34.68 -83.03 329 30 LYS A 35 ? ? 177.05 -166.10 330 30 LEU A 36 ? ? 64.83 63.10 331 30 HIS A 39 ? ? 65.56 152.19 332 30 ALA A 45 ? ? -106.31 77.89 333 30 ASP A 46 ? ? -97.43 -60.53 334 30 LEU A 61 ? ? 162.22 42.69 335 30 PHE A 63 ? ? -138.12 -45.63 336 30 ALA A 65 ? ? -42.63 156.57 337 30 CYS A 83 ? ? 68.09 -67.64 338 30 GLU A 84 ? ? 159.00 171.62 339 30 ARG A 87 ? ? 59.17 -83.70 340 30 ALA A 89 ? ? -121.25 -59.65 341 30 MET A 91 ? ? 37.20 73.77 342 31 LYS A 35 ? ? -172.15 -170.07 343 31 LEU A 36 ? ? 68.28 70.21 344 31 HIS A 39 ? ? -176.96 148.02 345 31 PHE A 63 ? ? -133.33 -47.03 346 31 CYS A 83 ? ? -41.50 99.29 347 31 HIS A 86 ? ? -162.77 -69.32 348 31 ARG A 87 ? ? -171.37 -48.75 349 31 MET A 91 ? ? 78.17 -52.46 350 31 VAL A 92 ? ? 54.08 -101.70 351 32 MET A 7 ? ? -35.79 -71.56 352 32 LYS A 35 ? ? -178.80 -170.19 353 32 ALA A 45 ? ? -113.69 75.20 354 32 ASP A 46 ? ? -91.67 -81.60 355 32 LEU A 61 ? ? 80.82 135.34 356 32 GLU A 84 ? ? -172.77 -60.79 357 32 ALA A 89 ? ? -113.53 -73.65 358 33 SER A 11 ? ? -52.22 -70.22 359 33 ASN A 34 ? ? -58.64 -71.21 360 33 LYS A 35 ? ? -170.29 -172.66 361 33 LEU A 36 ? ? 65.13 65.85 362 33 LYS A 59 ? ? -99.04 34.00 363 33 LEU A 61 ? ? -165.52 119.70 364 33 PHE A 63 ? ? -123.11 -70.21 365 33 GLU A 84 ? ? 55.48 171.34 366 33 HIS A 86 ? ? -68.83 76.82 367 33 ARG A 87 ? ? 65.91 -70.47 368 33 ALA A 89 ? ? -172.12 -68.43 369 33 VAL A 92 ? ? 44.11 -165.69 370 34 ASN A 34 ? ? -108.93 -61.71 371 34 LEU A 36 ? ? 75.63 70.05 372 34 LEU A 61 ? ? 72.45 124.84 373 34 PHE A 63 ? ? -132.69 -43.52 374 34 TYR A 82 ? ? -163.15 -164.57 375 34 PRO A 85 ? ? -74.95 -88.06 376 34 HIS A 86 ? ? -39.59 118.12 377 34 ARG A 87 ? ? -39.49 96.59 378 34 MET A 91 ? ? 37.82 73.10 379 34 VAL A 92 ? ? -81.91 -90.02 380 35 ALA A 25 ? ? -61.50 95.22 381 35 ASN A 34 ? ? -96.31 -62.09 382 35 LYS A 35 ? ? 179.95 -172.59 383 35 SER A 37 ? ? -49.97 162.04 384 35 HIS A 39 ? ? 69.37 100.43 385 35 LYS A 59 ? ? -94.30 39.75 386 35 PHE A 63 ? ? -156.71 -51.68 387 35 ALA A 65 ? ? -67.51 74.05 388 35 TYR A 82 ? ? -167.41 117.43 389 35 PRO A 85 ? ? -75.00 -80.76 390 35 HIS A 86 ? ? 66.81 -69.31 391 35 ARG A 87 ? ? 85.72 63.02 392 35 ALA A 89 ? ? 64.16 96.96 393 35 MET A 91 ? ? -127.41 -54.66 394 35 VAL A 92 ? ? 71.98 169.51 # _pdbx_nmr_ensemble.entry_id 1J5C _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 35 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1J5C _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '3 mM plastocyanin U-15N 50 mM phosphate buffer' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 HNHA 3 1 1 NOE 4 1 1 'proton T1 (HSQC)' # _pdbx_nmr_refine.entry_id 1J5C _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;The protein contains paramagnetic copper(II), whose electronic relaxation times are quite unfavorable for NMR solution studies. The structure has been solved on the basis of 1041 meaningful NOESY cross peaks, 18 1D NOEs, 26 T1 values, 96 dihedral angle constraints and 18 H-bonds. The detection of broad hyperfine shifted signals and their full assignment allowed the identification of the copper(II) ligands and the determination of the Cu-S-C-H dihedral angle for the coordinated cysteine. The global root mean square deviation from the mean structure for the solution structure family is 0.72 and 1.16 for backbone and heavy atoms, respectively. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.0 collection Bruker 1 XwinNMR 2.0 'data analysis' Bruker 2 XEASY 1.3.13 'data analysis' 'Xia, Bartels' 3 DYANA 1.5 refinement Guentert 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLU N N N N 89 GLU CA C N S 90 GLU C C N N 91 GLU O O N N 92 GLU CB C N N 93 GLU CG C N N 94 GLU CD C N N 95 GLU OE1 O N N 96 GLU OE2 O N N 97 GLU OXT O N N 98 GLU H H N N 99 GLU H2 H N N 100 GLU HA H N N 101 GLU HB2 H N N 102 GLU HB3 H N N 103 GLU HG2 H N N 104 GLU HG3 H N N 105 GLU HE2 H N N 106 GLU HXT H N N 107 GLY N N N N 108 GLY CA C N N 109 GLY C C N N 110 GLY O O N N 111 GLY OXT O N N 112 GLY H H N N 113 GLY H2 H N N 114 GLY HA2 H N N 115 GLY HA3 H N N 116 GLY HXT H N N 117 HIS N N N N 118 HIS CA C N S 119 HIS C C N N 120 HIS O O N N 121 HIS CB C N N 122 HIS CG C Y N 123 HIS ND1 N Y N 124 HIS CD2 C Y N 125 HIS CE1 C Y N 126 HIS NE2 N Y N 127 HIS OXT O N N 128 HIS H H N N 129 HIS H2 H N N 130 HIS HA H N N 131 HIS HB2 H N N 132 HIS HB3 H N N 133 HIS HD1 H N N 134 HIS HD2 H N N 135 HIS HE1 H N N 136 HIS HE2 H N N 137 HIS HXT H N N 138 ILE N N N N 139 ILE CA C N S 140 ILE C C N N 141 ILE O O N N 142 ILE CB C N S 143 ILE CG1 C N N 144 ILE CG2 C N N 145 ILE CD1 C N N 146 ILE OXT O N N 147 ILE H H N N 148 ILE H2 H N N 149 ILE HA H N N 150 ILE HB H N N 151 ILE HG12 H N N 152 ILE HG13 H N N 153 ILE HG21 H N N 154 ILE HG22 H N N 155 ILE HG23 H N N 156 ILE HD11 H N N 157 ILE HD12 H N N 158 ILE HD13 H N N 159 ILE HXT H N N 160 LEU N N N N 161 LEU CA C N S 162 LEU C C N N 163 LEU O O N N 164 LEU CB C N N 165 LEU CG C N N 166 LEU CD1 C N N 167 LEU CD2 C N N 168 LEU OXT O N N 169 LEU H H N N 170 LEU H2 H N N 171 LEU HA H N N 172 LEU HB2 H N N 173 LEU HB3 H N N 174 LEU HG H N N 175 LEU HD11 H N N 176 LEU HD12 H N N 177 LEU HD13 H N N 178 LEU HD21 H N N 179 LEU HD22 H N N 180 LEU HD23 H N N 181 LEU HXT H N N 182 LYS N N N N 183 LYS CA C N S 184 LYS C C N N 185 LYS O O N N 186 LYS CB C N N 187 LYS CG C N N 188 LYS CD C N N 189 LYS CE C N N 190 LYS NZ N N N 191 LYS OXT O N N 192 LYS H H N N 193 LYS H2 H N N 194 LYS HA H N N 195 LYS HB2 H N N 196 LYS HB3 H N N 197 LYS HG2 H N N 198 LYS HG3 H N N 199 LYS HD2 H N N 200 LYS HD3 H N N 201 LYS HE2 H N N 202 LYS HE3 H N N 203 LYS HZ1 H N N 204 LYS HZ2 H N N 205 LYS HZ3 H N N 206 LYS HXT H N N 207 MET N N N N 208 MET CA C N S 209 MET C C N N 210 MET O O N N 211 MET CB C N N 212 MET CG C N N 213 MET SD S N N 214 MET CE C N N 215 MET OXT O N N 216 MET H H N N 217 MET H2 H N N 218 MET HA H N N 219 MET HB2 H N N 220 MET HB3 H N N 221 MET HG2 H N N 222 MET HG3 H N N 223 MET HE1 H N N 224 MET HE2 H N N 225 MET HE3 H N N 226 MET HXT H N N 227 PHE N N N N 228 PHE CA C N S 229 PHE C C N N 230 PHE O O N N 231 PHE CB C N N 232 PHE CG C Y N 233 PHE CD1 C Y N 234 PHE CD2 C Y N 235 PHE CE1 C Y N 236 PHE CE2 C Y N 237 PHE CZ C Y N 238 PHE OXT O N N 239 PHE H H N N 240 PHE H2 H N N 241 PHE HA H N N 242 PHE HB2 H N N 243 PHE HB3 H N N 244 PHE HD1 H N N 245 PHE HD2 H N N 246 PHE HE1 H N N 247 PHE HE2 H N N 248 PHE HZ H N N 249 PHE HXT H N N 250 PRO N N N N 251 PRO CA C N S 252 PRO C C N N 253 PRO O O N N 254 PRO CB C N N 255 PRO CG C N N 256 PRO CD C N N 257 PRO OXT O N N 258 PRO H H N N 259 PRO HA H N N 260 PRO HB2 H N N 261 PRO HB3 H N N 262 PRO HG2 H N N 263 PRO HG3 H N N 264 PRO HD2 H N N 265 PRO HD3 H N N 266 PRO HXT H N N 267 SER N N N N 268 SER CA C N S 269 SER C C N N 270 SER O O N N 271 SER CB C N N 272 SER OG O N N 273 SER OXT O N N 274 SER H H N N 275 SER H2 H N N 276 SER HA H N N 277 SER HB2 H N N 278 SER HB3 H N N 279 SER HG H N N 280 SER HXT H N N 281 THR N N N N 282 THR CA C N S 283 THR C C N N 284 THR O O N N 285 THR CB C N R 286 THR OG1 O N N 287 THR CG2 C N N 288 THR OXT O N N 289 THR H H N N 290 THR H2 H N N 291 THR HA H N N 292 THR HB H N N 293 THR HG1 H N N 294 THR HG21 H N N 295 THR HG22 H N N 296 THR HG23 H N N 297 THR HXT H N N 298 TRP N N N N 299 TRP CA C N S 300 TRP C C N N 301 TRP O O N N 302 TRP CB C N N 303 TRP CG C Y N 304 TRP CD1 C Y N 305 TRP CD2 C Y N 306 TRP NE1 N Y N 307 TRP CE2 C Y N 308 TRP CE3 C Y N 309 TRP CZ2 C Y N 310 TRP CZ3 C Y N 311 TRP CH2 C Y N 312 TRP OXT O N N 313 TRP H H N N 314 TRP H2 H N N 315 TRP HA H N N 316 TRP HB2 H N N 317 TRP HB3 H N N 318 TRP HD1 H N N 319 TRP HE1 H N N 320 TRP HE3 H N N 321 TRP HZ2 H N N 322 TRP HZ3 H N N 323 TRP HH2 H N N 324 TRP HXT H N N 325 TYR N N N N 326 TYR CA C N S 327 TYR C C N N 328 TYR O O N N 329 TYR CB C N N 330 TYR CG C Y N 331 TYR CD1 C Y N 332 TYR CD2 C Y N 333 TYR CE1 C Y N 334 TYR CE2 C Y N 335 TYR CZ C Y N 336 TYR OH O N N 337 TYR OXT O N N 338 TYR H H N N 339 TYR H2 H N N 340 TYR HA H N N 341 TYR HB2 H N N 342 TYR HB3 H N N 343 TYR HD1 H N N 344 TYR HD2 H N N 345 TYR HE1 H N N 346 TYR HE2 H N N 347 TYR HH H N N 348 TYR HXT H N N 349 VAL N N N N 350 VAL CA C N S 351 VAL C C N N 352 VAL O O N N 353 VAL CB C N N 354 VAL CG1 C N N 355 VAL CG2 C N N 356 VAL OXT O N N 357 VAL H H N N 358 VAL H2 H N N 359 VAL HA H N N 360 VAL HB H N N 361 VAL HG11 H N N 362 VAL HG12 H N N 363 VAL HG13 H N N 364 VAL HG21 H N N 365 VAL HG22 H N N 366 VAL HG23 H N N 367 VAL HXT H N N 368 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? Bruker AVANCE 800 # _atom_sites.entry_id 1J5C _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU H N O S # loop_