data_1J6V
# 
_entry.id   1J6V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1J6V         pdb_00001j6v 10.2210/pdb1j6v/pdb 
RCSB  RCSB013433   ?            ?                   
WWPDB D_1000013433 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-08 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Database references'       
7 5 'Structure model' 'Derived calculations'      
8 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' software                  
2  5 'Structure model' chem_comp_atom            
3  5 'Structure model' chem_comp_bond            
4  5 'Structure model' database_2                
5  5 'Structure model' pdbx_entry_details        
6  5 'Structure model' pdbx_modification_feature 
7  5 'Structure model' pdbx_struct_conn_angle    
8  5 'Structure model' struct_conn               
9  5 'Structure model' struct_ref_seq_dif        
10 5 'Structure model' struct_site               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_database_2.pdbx_DOI'                        
2  5 'Structure model' '_database_2.pdbx_database_accession'         
3  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
15 5 'Structure model' '_pdbx_struct_conn_angle.value'               
16 5 'Structure model' '_struct_conn.pdbx_dist_value'                
17 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
18 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
19 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
21 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
25 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
26 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
27 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
28 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
29 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
30 5 'Structure model' '_struct_ref_seq_dif.details'                 
31 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
32 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
33 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1J6V 
_pdbx_database_status.recvd_initial_deposition_date   2001-05-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lewis, H.A.'     1 
'Furlong, E.B.'   2 
'Bergseid, M.G.'  3 
'Sanderson, W.E.' 4 
'Buchanan, S.G.'  5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.' Structure 9  
527 537 2001 STRUE6 UK 0969-2126 2005 ? 11435117 '10.1016/S0969-2126(01)00613-X' 
1       'Structural analysis of a set of proteins resulting from a bacterial genomics project'                       Proteins  60 
787 796 2005 PSFGEY US 0887-3585 0867 ? 16021622 10.1002/prot.20541              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lewis, H.A.'            1  ? 
primary 'Furlong, E.B.'          2  ? 
primary 'Laubert, B.'            3  ? 
primary 'Eroshkina, G.A.'        4  ? 
primary 'Batiyenko, Y.'          5  ? 
primary 'Adams, J.M.'            6  ? 
primary 'Bergseid, M.G.'         7  ? 
primary 'Marsh, C.D.'            8  ? 
primary 'Peat, T.S.'             9  ? 
primary 'Sanderson, W.E.'        10 ? 
primary 'Sauder, J.M.'           11 ? 
primary 'Buchanan, S.G.'         12 ? 
1       'Badger, J.'             13 ? 
1       'Sauder, J.M.'           14 ? 
1       'Adams, J.M.'            15 ? 
1       'Antonysamy, S.'         16 ? 
1       'Bain, K.'               17 ? 
1       'Bergseid, M.G.'         18 ? 
1       'Buchanan, S.G.'         19 ? 
1       'Buchanan, M.D.'         20 ? 
1       'Batiyenko, Y.'          21 ? 
1       'Christopher, J.A.'      22 ? 
1       'Emtage, S.'             23 ? 
1       'Eroshkina, A.'          24 ? 
1       'Feil, I.'               25 ? 
1       'Furlong, E.B.'          26 ? 
1       'Gajiwala, K.S.'         27 ? 
1       'Gao, X.'                28 ? 
1       'He, D.'                 29 ? 
1       'Hendle, J.'             30 ? 
1       'Huber, A.'              31 ? 
1       'Hoda, K.'               32 ? 
1       'Kearins, P.'            33 ? 
1       'Kissinger, C.'          34 ? 
1       'Laubert, B.'            35 ? 
1       'Lewis, H.A.'            36 ? 
1       'Lin, J.'                37 ? 
1       'Loomis, K.'             38 ? 
1       'Lorimer, D.'            39 ? 
1       'Louie, G.'              40 ? 
1       'Maletic, M.'            41 ? 
1       'Marsh, C.D.'            42 ? 
1       'Miller, I.'             43 ? 
1       'Molinari, J.'           44 ? 
1       'Muller-Dieckmann, H.J.' 45 ? 
1       'Newman, J.M.'           46 ? 
1       'Noland, B.W.'           47 ? 
1       'Pagarigan, B.'          48 ? 
1       'Park, F.'               49 ? 
1       'Peat, T.S.'             50 ? 
1       'Post, K.W.'             51 ? 
1       'Radojicic, S.'          52 ? 
1       'Ramos, A.'              53 ? 
1       'Romero, R.'             54 ? 
1       'Rutter, M.E.'           55 ? 
1       'Sanderson, W.E.'        56 ? 
1       'Schwinn, K.D.'          57 ? 
1       'Tresser, J.'            58 ? 
1       'Winhoven, J.'           59 ? 
1       'Wright, T.A.'           60 ? 
1       'Wu, L.'                 61 ? 
1       'Xu, J.'                 62 ? 
1       'Harris, T.J.'           63 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'AUTOINDUCER-2 PRODUCTION PROTEIN LUXS' 18719.035 1  ? ? ? ? 
2 non-polymer syn 'ZINC ION'                              65.409    1  ? ? ? ? 
3 water       nat water                                   18.015    46 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AI-2 SYNTHESIS PROTEIN, CONSERVED HYPOTHETICAL PROTEIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)PD(MSE)ANVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGY(MSE)R
DHLEGVVDVSP(MSE)GCRTG(MSE)Y(MSE)AVIGEPDEQGV(MSE)KAFEAALKDTAGHDQPIPGVSELECGNYRDHD
LAAARQHARDVLDQGLKVQETILLERGSHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPDMANVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPM
GCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLERGS
HHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   PRO n 
1 3   ASP n 
1 4   MSE n 
1 5   ALA n 
1 6   ASN n 
1 7   VAL n 
1 8   GLU n 
1 9   SER n 
1 10  PHE n 
1 11  ASP n 
1 12  LEU n 
1 13  ASP n 
1 14  HIS n 
1 15  THR n 
1 16  LYS n 
1 17  VAL n 
1 18  LYS n 
1 19  ALA n 
1 20  PRO n 
1 21  TYR n 
1 22  VAL n 
1 23  ARG n 
1 24  LEU n 
1 25  ALA n 
1 26  GLY n 
1 27  VAL n 
1 28  LYS n 
1 29  THR n 
1 30  THR n 
1 31  PRO n 
1 32  LYS n 
1 33  GLY n 
1 34  ASP n 
1 35  GLN n 
1 36  ILE n 
1 37  SER n 
1 38  LYS n 
1 39  TYR n 
1 40  ASP n 
1 41  LEU n 
1 42  ARG n 
1 43  PHE n 
1 44  LEU n 
1 45  GLN n 
1 46  PRO n 
1 47  ASN n 
1 48  GLN n 
1 49  GLY n 
1 50  ALA n 
1 51  ILE n 
1 52  ASP n 
1 53  PRO n 
1 54  ALA n 
1 55  ALA n 
1 56  ILE n 
1 57  HIS n 
1 58  THR n 
1 59  LEU n 
1 60  GLU n 
1 61  HIS n 
1 62  LEU n 
1 63  LEU n 
1 64  ALA n 
1 65  GLY n 
1 66  TYR n 
1 67  MSE n 
1 68  ARG n 
1 69  ASP n 
1 70  HIS n 
1 71  LEU n 
1 72  GLU n 
1 73  GLY n 
1 74  VAL n 
1 75  VAL n 
1 76  ASP n 
1 77  VAL n 
1 78  SER n 
1 79  PRO n 
1 80  MSE n 
1 81  GLY n 
1 82  CYS n 
1 83  ARG n 
1 84  THR n 
1 85  GLY n 
1 86  MSE n 
1 87  TYR n 
1 88  MSE n 
1 89  ALA n 
1 90  VAL n 
1 91  ILE n 
1 92  GLY n 
1 93  GLU n 
1 94  PRO n 
1 95  ASP n 
1 96  GLU n 
1 97  GLN n 
1 98  GLY n 
1 99  VAL n 
1 100 MSE n 
1 101 LYS n 
1 102 ALA n 
1 103 PHE n 
1 104 GLU n 
1 105 ALA n 
1 106 ALA n 
1 107 LEU n 
1 108 LYS n 
1 109 ASP n 
1 110 THR n 
1 111 ALA n 
1 112 GLY n 
1 113 HIS n 
1 114 ASP n 
1 115 GLN n 
1 116 PRO n 
1 117 ILE n 
1 118 PRO n 
1 119 GLY n 
1 120 VAL n 
1 121 SER n 
1 122 GLU n 
1 123 LEU n 
1 124 GLU n 
1 125 CYS n 
1 126 GLY n 
1 127 ASN n 
1 128 TYR n 
1 129 ARG n 
1 130 ASP n 
1 131 HIS n 
1 132 ASP n 
1 133 LEU n 
1 134 ALA n 
1 135 ALA n 
1 136 ALA n 
1 137 ARG n 
1 138 GLN n 
1 139 HIS n 
1 140 ALA n 
1 141 ARG n 
1 142 ASP n 
1 143 VAL n 
1 144 LEU n 
1 145 ASP n 
1 146 GLN n 
1 147 GLY n 
1 148 LEU n 
1 149 LYS n 
1 150 VAL n 
1 151 GLN n 
1 152 GLU n 
1 153 THR n 
1 154 ILE n 
1 155 LEU n 
1 156 LEU n 
1 157 GLU n 
1 158 ARG n 
1 159 GLY n 
1 160 SER n 
1 161 HIS n 
1 162 HIS n 
1 163 HIS n 
1 164 HIS n 
1 165 HIS n 
1 166 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Deinococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Deinococcus radiodurans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1299 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'       ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   MSE 4   4   ?   ?   ?   A . n 
A 1 5   ALA 5   5   ?   ?   ?   A . n 
A 1 6   ASN 6   6   ?   ?   ?   A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  HIS 14  14  14  HIS HIS A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  HIS 61  61  61  HIS HIS A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  MSE 67  67  67  MSE MSE A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  MSE 80  80  80  MSE MSE A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  CYS 82  82  82  CYS CYS A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  MSE 86  86  86  MSE MSE A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  MSE 88  88  88  MSE MSE A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 MSE 100 100 100 MSE MSE A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 HIS 113 113 113 HIS HIS A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 CYS 125 125 125 CYS CYS A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 HIS 131 131 131 HIS HIS A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 GLN 138 138 138 GLN GLN A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 ARG 158 158 ?   ?   ?   A . n 
A 1 159 GLY 159 159 ?   ?   ?   A . n 
A 1 160 SER 160 160 ?   ?   ?   A . n 
A 1 161 HIS 161 161 ?   ?   ?   A . n 
A 1 162 HIS 162 162 ?   ?   ?   A . n 
A 1 163 HIS 163 163 ?   ?   ?   A . n 
A 1 164 HIS 164 164 ?   ?   ?   A . n 
A 1 165 HIS 165 165 ?   ?   ?   A . n 
A 1 166 HIS 166 166 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  167 1  ZN  ZN  A . 
C 3 HOH 1  168 2  HOH HOH A . 
C 3 HOH 2  169 3  HOH HOH A . 
C 3 HOH 3  170 4  HOH HOH A . 
C 3 HOH 4  171 5  HOH HOH A . 
C 3 HOH 5  172 6  HOH HOH A . 
C 3 HOH 6  173 7  HOH HOH A . 
C 3 HOH 7  174 8  HOH HOH A . 
C 3 HOH 8  175 9  HOH HOH A . 
C 3 HOH 9  176 10 HOH HOH A . 
C 3 HOH 10 177 11 HOH HOH A . 
C 3 HOH 11 178 12 HOH HOH A . 
C 3 HOH 12 179 13 HOH HOH A . 
C 3 HOH 13 180 14 HOH HOH A . 
C 3 HOH 14 181 15 HOH HOH A . 
C 3 HOH 15 182 16 HOH HOH A . 
C 3 HOH 16 183 17 HOH HOH A . 
C 3 HOH 17 184 18 HOH HOH A . 
C 3 HOH 18 185 19 HOH HOH A . 
C 3 HOH 19 186 20 HOH HOH A . 
C 3 HOH 20 187 21 HOH HOH A . 
C 3 HOH 21 188 22 HOH HOH A . 
C 3 HOH 22 189 23 HOH HOH A . 
C 3 HOH 23 190 24 HOH HOH A . 
C 3 HOH 24 191 25 HOH HOH A . 
C 3 HOH 25 192 26 HOH HOH A . 
C 3 HOH 26 193 27 HOH HOH A . 
C 3 HOH 27 194 28 HOH HOH A . 
C 3 HOH 28 195 29 HOH HOH A . 
C 3 HOH 29 196 30 HOH HOH A . 
C 3 HOH 30 197 31 HOH HOH A . 
C 3 HOH 31 198 32 HOH HOH A . 
C 3 HOH 32 199 33 HOH HOH A . 
C 3 HOH 33 200 34 HOH HOH A . 
C 3 HOH 34 201 35 HOH HOH A . 
C 3 HOH 35 202 36 HOH HOH A . 
C 3 HOH 36 203 37 HOH HOH A . 
C 3 HOH 37 204 38 HOH HOH A . 
C 3 HOH 38 205 39 HOH HOH A . 
C 3 HOH 39 206 40 HOH HOH A . 
C 3 HOH 40 207 41 HOH HOH A . 
C 3 HOH 41 208 42 HOH HOH A . 
C 3 HOH 42 209 43 HOH HOH A . 
C 3 HOH 43 210 44 HOH HOH A . 
C 3 HOH 44 211 45 HOH HOH A . 
C 3 HOH 45 212 46 HOH HOH A . 
C 3 HOH 46 213 47 HOH HOH A . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345    'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
AMoRE     phasing           . ? 3 
CNS       refinement        . ? 4 
# 
_cell.entry_id           1J6V 
_cell.length_a           51.190 
_cell.length_b           70.140 
_cell.length_c           49.730 
_cell.angle_alpha        90.00 
_cell.angle_beta         112.03 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1J6V 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     monoclinic 
_symmetry.Int_Tables_number                5 
# 
_exptl.entry_id          1J6V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   49.3 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG MME 5000, MES, BME, NaCl, , pH 6.5, VAPOR DIFFUSION, HANGING DROP at 277K, temperature 277.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-09-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9641 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 32-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   32-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9641 
# 
_reflns.entry_id                     1J6V 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             35.0 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   9260 
_reflns.number_all                   9556 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.9 
_reflns.B_iso_Wilson_estimate        14.7 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.094 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1J6V 
_refine.ls_number_reflns_obs                     9260 
_refine.ls_number_reflns_all                     9556 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             35.0 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          0.201 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.243 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  926 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1162 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               1209 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        35.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_database_PDB_matrix.entry_id          1J6V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1J6V 
_struct.title                     'CRYSTAL STRUCTURE OF D. RADIODURANS LUXS, C2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1J6V 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'alpha-beta fold, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LUXS_DEIRA 
_struct_ref.pdbx_db_accession          Q9RRU8 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MPDMANVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPM
GCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLER
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1J6V 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 158 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9RRU8 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  158 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       158 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1J6V MSE A 1   ? UNP Q9RRU8 MET 1   'cloning artifact' 1   1  
1 1J6V MSE A 4   ? UNP Q9RRU8 MET 4   'cloning artifact' 4   2  
1 1J6V MSE A 67  ? UNP Q9RRU8 MET 67  'cloning artifact' 67  3  
1 1J6V MSE A 80  ? UNP Q9RRU8 MET 80  'cloning artifact' 80  4  
1 1J6V MSE A 86  ? UNP Q9RRU8 MET 86  'cloning artifact' 86  5  
1 1J6V MSE A 88  ? UNP Q9RRU8 MET 88  'cloning artifact' 88  6  
1 1J6V MSE A 100 ? UNP Q9RRU8 MET 100 'cloning artifact' 100 7  
1 1J6V GLY A 159 ? UNP Q9RRU8 ?   ?   'expression tag'   159 8  
1 1J6V SER A 160 ? UNP Q9RRU8 ?   ?   'expression tag'   160 9  
1 1J6V HIS A 161 ? UNP Q9RRU8 ?   ?   'expression tag'   161 10 
1 1J6V HIS A 162 ? UNP Q9RRU8 ?   ?   'expression tag'   162 11 
1 1J6V HIS A 163 ? UNP Q9RRU8 ?   ?   'expression tag'   163 12 
1 1J6V HIS A 164 ? UNP Q9RRU8 ?   ?   'expression tag'   164 13 
1 1J6V HIS A 165 ? UNP Q9RRU8 ?   ?   'expression tag'   165 14 
1 1J6V HIS A 166 ? UNP Q9RRU8 ?   ?   'expression tag'   166 15 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3700  ? 
1 MORE         -92   ? 
1 'SSA (A^2)'  12510 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 32.5366741252 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 46.0990925486 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 52  ? LEU A 71  ? ASP A 52  LEU A 71  1 ? 20 
HELX_P HELX_P2 2 ASP A 95  ? GLY A 112 ? ASP A 95  GLY A 112 1 ? 18 
HELX_P HELX_P3 3 ASP A 132 ? GLY A 147 ? ASP A 132 GLY A 147 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A TYR 66  C   ? ? ? 1_555 A MSE 67  N  ? ? A TYR 66  A MSE 67  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale2  covale both ? A MSE 67  C   ? ? ? 1_555 A ARG 68  N  ? ? A MSE 67  A ARG 68  1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale3  covale both ? A PRO 79  C   ? ? ? 1_555 A MSE 80  N  ? ? A PRO 79  A MSE 80  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale4  covale both ? A MSE 80  C   ? ? ? 1_555 A GLY 81  N  ? ? A MSE 80  A GLY 81  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale5  covale both ? A GLY 85  C   ? ? ? 1_555 A MSE 86  N  ? ? A GLY 85  A MSE 86  1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale6  covale both ? A MSE 86  C   ? ? ? 1_555 A TYR 87  N  ? ? A MSE 86  A TYR 87  1_555 ? ? ? ? ? ? ? 1.323 ? ? 
covale7  covale both ? A TYR 87  C   ? ? ? 1_555 A MSE 88  N  ? ? A TYR 87  A MSE 88  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale8  covale both ? A MSE 88  C   ? ? ? 1_555 A ALA 89  N  ? ? A MSE 88  A ALA 89  1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale9  covale both ? A VAL 99  C   ? ? ? 1_555 A MSE 100 N  ? ? A VAL 99  A MSE 100 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale10 covale both ? A MSE 100 C   ? ? ? 1_555 A LYS 101 N  ? ? A MSE 100 A LYS 101 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
metalc1  metalc ?    ? A HIS 57  NE2 ? ? ? 1_555 B ZN  .   ZN ? ? A HIS 57  A ZN  167 1_555 ? ? ? ? ? ? ? 2.229 ? ? 
metalc2  metalc ?    ? A HIS 61  NE2 ? ? ? 1_555 B ZN  .   ZN ? ? A HIS 61  A ZN  167 1_555 ? ? ? ? ? ? ? 2.160 ? ? 
metalc3  metalc ?    ? A CYS 125 SG  ? ? ? 1_555 B ZN  .   ZN ? ? A CYS 125 A ZN  167 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc4  metalc ?    ? B ZN  .   ZN  ? ? ? 1_555 C HOH .   O  ? ? A ZN  167 A HOH 168 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 57  ? A HIS 57  ? 1_555 ZN ? B ZN . ? A ZN 167 ? 1_555 NE2 ? A HIS 61  ? A HIS 61  ? 1_555 102.3 ? 
2 NE2 ? A HIS 57  ? A HIS 57  ? 1_555 ZN ? B ZN . ? A ZN 167 ? 1_555 SG  ? A CYS 125 ? A CYS 125 ? 1_555 101.3 ? 
3 NE2 ? A HIS 61  ? A HIS 61  ? 1_555 ZN ? B ZN . ? A ZN 167 ? 1_555 SG  ? A CYS 125 ? A CYS 125 ? 1_555 110.7 ? 
4 NE2 ? A HIS 57  ? A HIS 57  ? 1_555 ZN ? B ZN . ? A ZN 167 ? 1_555 O   ? C HOH .   ? A HOH 168 ? 1_555 116.0 ? 
5 NE2 ? A HIS 61  ? A HIS 61  ? 1_555 ZN ? B ZN . ? A ZN 167 ? 1_555 O   ? C HOH .   ? A HOH 168 ? 1_555 116.2 ? 
6 SG  ? A CYS 125 ? A CYS 125 ? 1_555 ZN ? B ZN . ? A ZN 167 ? 1_555 O   ? C HOH .   ? A HOH 168 ? 1_555 109.3 ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 MSE A 67  ? . . . . MSE A 67  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
2 MSE A 80  ? . . . . MSE A 80  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
3 MSE A 86  ? . . . . MSE A 86  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
4 MSE A 88  ? . . . . MSE A 88  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
5 MSE A 100 ? . . . . MSE A 100 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           19 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            19 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    20 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     20 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.14 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 21 ? THR A 29 ? TYR A 21 THR A 29 
A 2 GLN A 35 ? ARG A 42 ? GLN A 35 ARG A 42 
A 3 GLY A 85 ? ILE A 91 ? GLY A 85 ILE A 91 
A 4 VAL A 74 ? PRO A 79 ? VAL A 74 PRO A 79 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 28 ? O LYS A 28 N ILE A 36 ? N ILE A 36 
A 2 3 N LEU A 41 ? N LEU A 41 O MSE A 86 ? O MSE A 86 
A 3 4 O ALA A 89 ? O ALA A 89 N VAL A 75 ? N VAL A 75 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     167 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 167' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS A 57  ? HIS A 57  . ? 1_555 ? 
2 AC1 4 HIS A 61  ? HIS A 61  . ? 1_555 ? 
3 AC1 4 CYS A 125 ? CYS A 125 . ? 1_555 ? 
4 AC1 4 HOH C .   ? HOH A 168 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   1J6V 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    96 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    172 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 9   ? ? -163.88 93.57 
2 1 ASP A 95  ? ? -156.29 71.32 
3 1 ASN A 127 ? ? -157.79 58.69 
4 1 ASP A 130 ? ? -105.37 75.98 
5 1 ASP A 132 ? ? -153.66 87.33 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 67  A MSE 67  ? MET SELENOMETHIONINE 
2 A MSE 80  A MSE 80  ? MET SELENOMETHIONINE 
3 A MSE 86  A MSE 86  ? MET SELENOMETHIONINE 
4 A MSE 88  A MSE 88  ? MET SELENOMETHIONINE 
5 A MSE 100 A MSE 100 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE 1   ? A MSE 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A MSE 4   ? A MSE 4   
5  1 Y 1 A ALA 5   ? A ALA 5   
6  1 Y 1 A ASN 6   ? A ASN 6   
7  1 Y 1 A ARG 158 ? A ARG 158 
8  1 Y 1 A GLY 159 ? A GLY 159 
9  1 Y 1 A SER 160 ? A SER 160 
10 1 Y 1 A HIS 161 ? A HIS 161 
11 1 Y 1 A HIS 162 ? A HIS 162 
12 1 Y 1 A HIS 163 ? A HIS 163 
13 1 Y 1 A HIS 164 ? A HIS 164 
14 1 Y 1 A HIS 165 ? A HIS 165 
15 1 Y 1 A HIS 166 ? A HIS 166 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
HOH O    O  N N 158 
HOH H1   H  N N 159 
HOH H2   H  N N 160 
ILE N    N  N N 161 
ILE CA   C  N S 162 
ILE C    C  N N 163 
ILE O    O  N N 164 
ILE CB   C  N S 165 
ILE CG1  C  N N 166 
ILE CG2  C  N N 167 
ILE CD1  C  N N 168 
ILE OXT  O  N N 169 
ILE H    H  N N 170 
ILE H2   H  N N 171 
ILE HA   H  N N 172 
ILE HB   H  N N 173 
ILE HG12 H  N N 174 
ILE HG13 H  N N 175 
ILE HG21 H  N N 176 
ILE HG22 H  N N 177 
ILE HG23 H  N N 178 
ILE HD11 H  N N 179 
ILE HD12 H  N N 180 
ILE HD13 H  N N 181 
ILE HXT  H  N N 182 
LEU N    N  N N 183 
LEU CA   C  N S 184 
LEU C    C  N N 185 
LEU O    O  N N 186 
LEU CB   C  N N 187 
LEU CG   C  N N 188 
LEU CD1  C  N N 189 
LEU CD2  C  N N 190 
LEU OXT  O  N N 191 
LEU H    H  N N 192 
LEU H2   H  N N 193 
LEU HA   H  N N 194 
LEU HB2  H  N N 195 
LEU HB3  H  N N 196 
LEU HG   H  N N 197 
LEU HD11 H  N N 198 
LEU HD12 H  N N 199 
LEU HD13 H  N N 200 
LEU HD21 H  N N 201 
LEU HD22 H  N N 202 
LEU HD23 H  N N 203 
LEU HXT  H  N N 204 
LYS N    N  N N 205 
LYS CA   C  N S 206 
LYS C    C  N N 207 
LYS O    O  N N 208 
LYS CB   C  N N 209 
LYS CG   C  N N 210 
LYS CD   C  N N 211 
LYS CE   C  N N 212 
LYS NZ   N  N N 213 
LYS OXT  O  N N 214 
LYS H    H  N N 215 
LYS H2   H  N N 216 
LYS HA   H  N N 217 
LYS HB2  H  N N 218 
LYS HB3  H  N N 219 
LYS HG2  H  N N 220 
LYS HG3  H  N N 221 
LYS HD2  H  N N 222 
LYS HD3  H  N N 223 
LYS HE2  H  N N 224 
LYS HE3  H  N N 225 
LYS HZ1  H  N N 226 
LYS HZ2  H  N N 227 
LYS HZ3  H  N N 228 
LYS HXT  H  N N 229 
MET N    N  N N 230 
MET CA   C  N S 231 
MET C    C  N N 232 
MET O    O  N N 233 
MET CB   C  N N 234 
MET CG   C  N N 235 
MET SD   S  N N 236 
MET CE   C  N N 237 
MET OXT  O  N N 238 
MET H    H  N N 239 
MET H2   H  N N 240 
MET HA   H  N N 241 
MET HB2  H  N N 242 
MET HB3  H  N N 243 
MET HG2  H  N N 244 
MET HG3  H  N N 245 
MET HE1  H  N N 246 
MET HE2  H  N N 247 
MET HE3  H  N N 248 
MET HXT  H  N N 249 
MSE N    N  N N 250 
MSE CA   C  N S 251 
MSE C    C  N N 252 
MSE O    O  N N 253 
MSE OXT  O  N N 254 
MSE CB   C  N N 255 
MSE CG   C  N N 256 
MSE SE   SE N N 257 
MSE CE   C  N N 258 
MSE H    H  N N 259 
MSE H2   H  N N 260 
MSE HA   H  N N 261 
MSE HXT  H  N N 262 
MSE HB2  H  N N 263 
MSE HB3  H  N N 264 
MSE HG2  H  N N 265 
MSE HG3  H  N N 266 
MSE HE1  H  N N 267 
MSE HE2  H  N N 268 
MSE HE3  H  N N 269 
PHE N    N  N N 270 
PHE CA   C  N S 271 
PHE C    C  N N 272 
PHE O    O  N N 273 
PHE CB   C  N N 274 
PHE CG   C  Y N 275 
PHE CD1  C  Y N 276 
PHE CD2  C  Y N 277 
PHE CE1  C  Y N 278 
PHE CE2  C  Y N 279 
PHE CZ   C  Y N 280 
PHE OXT  O  N N 281 
PHE H    H  N N 282 
PHE H2   H  N N 283 
PHE HA   H  N N 284 
PHE HB2  H  N N 285 
PHE HB3  H  N N 286 
PHE HD1  H  N N 287 
PHE HD2  H  N N 288 
PHE HE1  H  N N 289 
PHE HE2  H  N N 290 
PHE HZ   H  N N 291 
PHE HXT  H  N N 292 
PRO N    N  N N 293 
PRO CA   C  N S 294 
PRO C    C  N N 295 
PRO O    O  N N 296 
PRO CB   C  N N 297 
PRO CG   C  N N 298 
PRO CD   C  N N 299 
PRO OXT  O  N N 300 
PRO H    H  N N 301 
PRO HA   H  N N 302 
PRO HB2  H  N N 303 
PRO HB3  H  N N 304 
PRO HG2  H  N N 305 
PRO HG3  H  N N 306 
PRO HD2  H  N N 307 
PRO HD3  H  N N 308 
PRO HXT  H  N N 309 
SER N    N  N N 310 
SER CA   C  N S 311 
SER C    C  N N 312 
SER O    O  N N 313 
SER CB   C  N N 314 
SER OG   O  N N 315 
SER OXT  O  N N 316 
SER H    H  N N 317 
SER H2   H  N N 318 
SER HA   H  N N 319 
SER HB2  H  N N 320 
SER HB3  H  N N 321 
SER HG   H  N N 322 
SER HXT  H  N N 323 
THR N    N  N N 324 
THR CA   C  N S 325 
THR C    C  N N 326 
THR O    O  N N 327 
THR CB   C  N R 328 
THR OG1  O  N N 329 
THR CG2  C  N N 330 
THR OXT  O  N N 331 
THR H    H  N N 332 
THR H2   H  N N 333 
THR HA   H  N N 334 
THR HB   H  N N 335 
THR HG1  H  N N 336 
THR HG21 H  N N 337 
THR HG22 H  N N 338 
THR HG23 H  N N 339 
THR HXT  H  N N 340 
TYR N    N  N N 341 
TYR CA   C  N S 342 
TYR C    C  N N 343 
TYR O    O  N N 344 
TYR CB   C  N N 345 
TYR CG   C  Y N 346 
TYR CD1  C  Y N 347 
TYR CD2  C  Y N 348 
TYR CE1  C  Y N 349 
TYR CE2  C  Y N 350 
TYR CZ   C  Y N 351 
TYR OH   O  N N 352 
TYR OXT  O  N N 353 
TYR H    H  N N 354 
TYR H2   H  N N 355 
TYR HA   H  N N 356 
TYR HB2  H  N N 357 
TYR HB3  H  N N 358 
TYR HD1  H  N N 359 
TYR HD2  H  N N 360 
TYR HE1  H  N N 361 
TYR HE2  H  N N 362 
TYR HH   H  N N 363 
TYR HXT  H  N N 364 
VAL N    N  N N 365 
VAL CA   C  N S 366 
VAL C    C  N N 367 
VAL O    O  N N 368 
VAL CB   C  N N 369 
VAL CG1  C  N N 370 
VAL CG2  C  N N 371 
VAL OXT  O  N N 372 
VAL H    H  N N 373 
VAL H2   H  N N 374 
VAL HA   H  N N 375 
VAL HB   H  N N 376 
VAL HG11 H  N N 377 
VAL HG12 H  N N 378 
VAL HG13 H  N N 379 
VAL HG21 H  N N 380 
VAL HG22 H  N N 381 
VAL HG23 H  N N 382 
VAL HXT  H  N N 383 
ZN  ZN   ZN N N 384 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MET N   CA   sing N N 218 
MET N   H    sing N N 219 
MET N   H2   sing N N 220 
MET CA  C    sing N N 221 
MET CA  CB   sing N N 222 
MET CA  HA   sing N N 223 
MET C   O    doub N N 224 
MET C   OXT  sing N N 225 
MET CB  CG   sing N N 226 
MET CB  HB2  sing N N 227 
MET CB  HB3  sing N N 228 
MET CG  SD   sing N N 229 
MET CG  HG2  sing N N 230 
MET CG  HG3  sing N N 231 
MET SD  CE   sing N N 232 
MET CE  HE1  sing N N 233 
MET CE  HE2  sing N N 234 
MET CE  HE3  sing N N 235 
MET OXT HXT  sing N N 236 
MSE N   CA   sing N N 237 
MSE N   H    sing N N 238 
MSE N   H2   sing N N 239 
MSE CA  C    sing N N 240 
MSE CA  CB   sing N N 241 
MSE CA  HA   sing N N 242 
MSE C   O    doub N N 243 
MSE C   OXT  sing N N 244 
MSE OXT HXT  sing N N 245 
MSE CB  CG   sing N N 246 
MSE CB  HB2  sing N N 247 
MSE CB  HB3  sing N N 248 
MSE CG  SE   sing N N 249 
MSE CG  HG2  sing N N 250 
MSE CG  HG3  sing N N 251 
MSE SE  CE   sing N N 252 
MSE CE  HE1  sing N N 253 
MSE CE  HE2  sing N N 254 
MSE CE  HE3  sing N N 255 
PHE N   CA   sing N N 256 
PHE N   H    sing N N 257 
PHE N   H2   sing N N 258 
PHE CA  C    sing N N 259 
PHE CA  CB   sing N N 260 
PHE CA  HA   sing N N 261 
PHE C   O    doub N N 262 
PHE C   OXT  sing N N 263 
PHE CB  CG   sing N N 264 
PHE CB  HB2  sing N N 265 
PHE CB  HB3  sing N N 266 
PHE CG  CD1  doub Y N 267 
PHE CG  CD2  sing Y N 268 
PHE CD1 CE1  sing Y N 269 
PHE CD1 HD1  sing N N 270 
PHE CD2 CE2  doub Y N 271 
PHE CD2 HD2  sing N N 272 
PHE CE1 CZ   doub Y N 273 
PHE CE1 HE1  sing N N 274 
PHE CE2 CZ   sing Y N 275 
PHE CE2 HE2  sing N N 276 
PHE CZ  HZ   sing N N 277 
PHE OXT HXT  sing N N 278 
PRO N   CA   sing N N 279 
PRO N   CD   sing N N 280 
PRO N   H    sing N N 281 
PRO CA  C    sing N N 282 
PRO CA  CB   sing N N 283 
PRO CA  HA   sing N N 284 
PRO C   O    doub N N 285 
PRO C   OXT  sing N N 286 
PRO CB  CG   sing N N 287 
PRO CB  HB2  sing N N 288 
PRO CB  HB3  sing N N 289 
PRO CG  CD   sing N N 290 
PRO CG  HG2  sing N N 291 
PRO CG  HG3  sing N N 292 
PRO CD  HD2  sing N N 293 
PRO CD  HD3  sing N N 294 
PRO OXT HXT  sing N N 295 
SER N   CA   sing N N 296 
SER N   H    sing N N 297 
SER N   H2   sing N N 298 
SER CA  C    sing N N 299 
SER CA  CB   sing N N 300 
SER CA  HA   sing N N 301 
SER C   O    doub N N 302 
SER C   OXT  sing N N 303 
SER CB  OG   sing N N 304 
SER CB  HB2  sing N N 305 
SER CB  HB3  sing N N 306 
SER OG  HG   sing N N 307 
SER OXT HXT  sing N N 308 
THR N   CA   sing N N 309 
THR N   H    sing N N 310 
THR N   H2   sing N N 311 
THR CA  C    sing N N 312 
THR CA  CB   sing N N 313 
THR CA  HA   sing N N 314 
THR C   O    doub N N 315 
THR C   OXT  sing N N 316 
THR CB  OG1  sing N N 317 
THR CB  CG2  sing N N 318 
THR CB  HB   sing N N 319 
THR OG1 HG1  sing N N 320 
THR CG2 HG21 sing N N 321 
THR CG2 HG22 sing N N 322 
THR CG2 HG23 sing N N 323 
THR OXT HXT  sing N N 324 
TYR N   CA   sing N N 325 
TYR N   H    sing N N 326 
TYR N   H2   sing N N 327 
TYR CA  C    sing N N 328 
TYR CA  CB   sing N N 329 
TYR CA  HA   sing N N 330 
TYR C   O    doub N N 331 
TYR C   OXT  sing N N 332 
TYR CB  CG   sing N N 333 
TYR CB  HB2  sing N N 334 
TYR CB  HB3  sing N N 335 
TYR CG  CD1  doub Y N 336 
TYR CG  CD2  sing Y N 337 
TYR CD1 CE1  sing Y N 338 
TYR CD1 HD1  sing N N 339 
TYR CD2 CE2  doub Y N 340 
TYR CD2 HD2  sing N N 341 
TYR CE1 CZ   doub Y N 342 
TYR CE1 HE1  sing N N 343 
TYR CE2 CZ   sing Y N 344 
TYR CE2 HE2  sing N N 345 
TYR CZ  OH   sing N N 346 
TYR OH  HH   sing N N 347 
TYR OXT HXT  sing N N 348 
VAL N   CA   sing N N 349 
VAL N   H    sing N N 350 
VAL N   H2   sing N N 351 
VAL CA  C    sing N N 352 
VAL CA  CB   sing N N 353 
VAL CA  HA   sing N N 354 
VAL C   O    doub N N 355 
VAL C   OXT  sing N N 356 
VAL CB  CG1  sing N N 357 
VAL CB  CG2  sing N N 358 
VAL CB  HB   sing N N 359 
VAL CG1 HG11 sing N N 360 
VAL CG1 HG12 sing N N 361 
VAL CG1 HG13 sing N N 362 
VAL CG2 HG21 sing N N 363 
VAL CG2 HG22 sing N N 364 
VAL CG2 HG23 sing N N 365 
VAL OXT HXT  sing N N 366 
# 
_atom_sites.entry_id                    1J6V 
_atom_sites.fract_transf_matrix[1][1]   0.019535 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007905 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014257 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021692 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
ZN 
# 
loop_