data_1J7M # _entry.id 1J7M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1J7M pdb_00001j7m 10.2210/pdb1j7m/pdb RCSB RCSB013460 ? ? WWPDB D_1000013460 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-05-30 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1J7M _pdbx_database_status.recvd_initial_deposition_date 2001-05-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1cxw _pdbx_database_related.details '1cxw is the second type II module from human matrix metalloproteinase 2' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Briknarova, K.' 1 'Gehrmann, M.' 2 'Banyai, L.' 3 'Tordai, H.' 4 'Patthy, L.' 5 'Llinas, M.' 6 # _citation.id primary _citation.title ;Gelatin-binding region of human matrix metalloproteinase-2: solution structure, dynamics, and function of the COL-23 two-domain construct. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 276 _citation.page_first 27613 _citation.page_last 27621 _citation.year 2001 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11320090 _citation.pdbx_database_id_DOI 10.1074/jbc.M101105200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Briknarova, K.' 1 ? primary 'Gehrmann, M.' 2 ? primary 'Banyai, L.' 3 ? primary 'Tordai, H.' 4 ? primary 'Patthy, L.' 5 ? primary 'Llinas, M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MATRIX METALLOPROTEINASE 2' _entity.formula_weight 7751.557 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.24.24 _entity.pdbx_mutation E11G _entity.pdbx_fragment 'third fibronectin type II module' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name '72 kDa type IV collagenase, gelatinase A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LAAHPPFASWMSTVGGNSGGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGWISS _entity_poly.pdbx_seq_one_letter_code_can LAAHPPFASWMSTVGGNSGGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGWISS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ALA n 1 3 ALA n 1 4 HIS n 1 5 PRO n 1 6 PRO n 1 7 PHE n 1 8 ALA n 1 9 SER n 1 10 TRP n 1 11 MET n 1 12 SER n 1 13 THR n 1 14 VAL n 1 15 GLY n 1 16 GLY n 1 17 ASN n 1 18 SER n 1 19 GLY n 1 20 GLY n 1 21 ALA n 1 22 PRO n 1 23 CYS n 1 24 VAL n 1 25 PHE n 1 26 PRO n 1 27 PHE n 1 28 THR n 1 29 PHE n 1 30 LEU n 1 31 GLY n 1 32 ASN n 1 33 LYS n 1 34 TYR n 1 35 GLU n 1 36 SER n 1 37 CYS n 1 38 THR n 1 39 SER n 1 40 ALA n 1 41 GLY n 1 42 ARG n 1 43 SER n 1 44 ASP n 1 45 GLY n 1 46 LYS n 1 47 MET n 1 48 TRP n 1 49 CYS n 1 50 ALA n 1 51 THR n 1 52 THR n 1 53 ALA n 1 54 ASN n 1 55 TYR n 1 56 ASP n 1 57 ASP n 1 58 ASP n 1 59 ARG n 1 60 LYS n 1 61 TRP n 1 62 GLY n 1 63 PHE n 1 64 CYS n 1 65 PRO n 1 66 ASP n 1 67 GLN n 1 68 GLY n 1 69 TRP n 1 70 ILE n 1 71 SER n 1 72 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pmed23 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 -7 ? ? ? A . n A 1 2 ALA 2 -6 ? ? ? A . n A 1 3 ALA 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 PRO 5 -3 ? ? ? A . n A 1 6 PRO 6 -2 ? ? ? A . n A 1 7 PHE 7 -1 ? ? ? A . n A 1 8 ALA 8 0 ? ? ? A . n A 1 9 SER 9 1 1 SER SER A . n A 1 10 TRP 10 2 2 TRP TRP A . n A 1 11 MET 11 3 3 MET MET A . n A 1 12 SER 12 4 4 SER SER A . n A 1 13 THR 13 5 5 THR THR A . n A 1 14 VAL 14 6 6 VAL VAL A . n A 1 15 GLY 15 7 7 GLY GLY A . n A 1 16 GLY 16 8 8 GLY GLY A . n A 1 17 ASN 17 9 9 ASN ASN A . n A 1 18 SER 18 10 10 SER SER A . n A 1 19 GLY 19 11 11 GLY GLY A . n A 1 20 GLY 20 12 12 GLY GLY A . n A 1 21 ALA 21 13 13 ALA ALA A . n A 1 22 PRO 22 14 14 PRO PRO A . n A 1 23 CYS 23 15 15 CYS CYS A . n A 1 24 VAL 24 16 16 VAL VAL A . n A 1 25 PHE 25 17 17 PHE PHE A . n A 1 26 PRO 26 18 18 PRO PRO A . n A 1 27 PHE 27 19 19 PHE PHE A . n A 1 28 THR 28 20 20 THR THR A . n A 1 29 PHE 29 21 21 PHE PHE A . n A 1 30 LEU 30 22 22 LEU LEU A . n A 1 31 GLY 31 23 23 GLY GLY A . n A 1 32 ASN 32 24 24 ASN ASN A . n A 1 33 LYS 33 25 25 LYS LYS A . n A 1 34 TYR 34 26 26 TYR TYR A . n A 1 35 GLU 35 27 27 GLU GLU A . n A 1 36 SER 36 28 28 SER SER A . n A 1 37 CYS 37 29 29 CYS CYS A . n A 1 38 THR 38 30 30 THR THR A . n A 1 39 SER 39 31 31 SER SER A . n A 1 40 ALA 40 32 32 ALA ALA A . n A 1 41 GLY 41 33 33 GLY GLY A . n A 1 42 ARG 42 34 34 ARG ARG A . n A 1 43 SER 43 35 35 SER SER A . n A 1 44 ASP 44 36 36 ASP ASP A . n A 1 45 GLY 45 37 37 GLY GLY A . n A 1 46 LYS 46 38 38 LYS LYS A . n A 1 47 MET 47 39 39 MET MET A . n A 1 48 TRP 48 40 40 TRP TRP A . n A 1 49 CYS 49 41 41 CYS CYS A . n A 1 50 ALA 50 42 42 ALA ALA A . n A 1 51 THR 51 43 43 THR THR A . n A 1 52 THR 52 44 44 THR THR A . n A 1 53 ALA 53 45 45 ALA ALA A . n A 1 54 ASN 54 46 46 ASN ASN A . n A 1 55 TYR 55 47 47 TYR TYR A . n A 1 56 ASP 56 48 48 ASP ASP A . n A 1 57 ASP 57 49 49 ASP ASP A . n A 1 58 ASP 58 50 50 ASP ASP A . n A 1 59 ARG 59 51 51 ARG ARG A . n A 1 60 LYS 60 52 52 LYS LYS A . n A 1 61 TRP 61 53 53 TRP TRP A . n A 1 62 GLY 62 54 54 GLY GLY A . n A 1 63 PHE 63 55 55 PHE PHE A . n A 1 64 CYS 64 56 56 CYS CYS A . n A 1 65 PRO 65 57 57 PRO PRO A . n A 1 66 ASP 66 58 58 ASP ASP A . n A 1 67 GLN 67 59 59 GLN GLN A . n A 1 68 GLY 68 60 60 GLY GLY A . n A 1 69 TRP 69 61 ? ? ? A . n A 1 70 ILE 70 62 ? ? ? A . n A 1 71 SER 71 63 ? ? ? A . n A 1 72 SER 72 64 ? ? ? A . n # _cell.entry_id 1J7M _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1J7M _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1J7M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1J7M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1J7M _struct.title 'The Third Fibronectin Type II Module from Human Matrix Metalloproteinase 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1J7M _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'beta sheet, alpha helix, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MMP2_HUMAN _struct_ref.pdbx_db_accession P08253 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQG _struct_ref.pdbx_align_begin 337 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1J7M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08253 _struct_ref_seq.db_align_beg 337 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 394 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1J7M LEU A 1 ? UNP P08253 ? ? 'cloning artifact' -7 1 1 1J7M ALA A 2 ? UNP P08253 ? ? 'cloning artifact' -6 2 1 1J7M ALA A 3 ? UNP P08253 ? ? 'cloning artifact' -5 3 1 1J7M HIS A 4 ? UNP P08253 ? ? 'cloning artifact' -4 4 1 1J7M PRO A 5 ? UNP P08253 ? ? 'cloning artifact' -3 5 1 1J7M PRO A 6 ? UNP P08253 ? ? 'cloning artifact' -2 6 1 1J7M PHE A 7 ? UNP P08253 ? ? 'cloning artifact' -1 7 1 1J7M ALA A 8 ? UNP P08253 ? ? 'cloning artifact' 0 8 1 1J7M SER A 9 ? UNP P08253 ? ? 'cloning artifact' 1 9 1 1J7M TRP A 10 ? UNP P08253 ? ? 'cloning artifact' 2 10 1 1J7M GLY A 19 ? UNP P08253 GLU 345 'see remark 999' 11 11 1 1J7M TRP A 69 ? UNP P08253 ? ? 'cloning artifact' 61 12 1 1J7M ILE A 70 ? UNP P08253 ? ? 'cloning artifact' 62 13 1 1J7M SER A 71 ? UNP P08253 ? ? 'cloning artifact' 63 14 1 1J7M SER A 72 ? UNP P08253 ? ? 'cloning artifact' 64 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 54 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 59 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 46 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 51 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 15 A CYS 41 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 29 A CYS 56 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 23 ? CYS A 49 ? CYS A 15 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 37 ? CYS A 64 ? CYS A 29 ? 1_555 CYS A 56 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 1 -0.29 2 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 2 -0.80 3 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 3 -0.53 4 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 4 -0.68 5 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 5 -0.88 6 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 6 -0.38 7 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 7 -0.44 8 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 8 -0.65 9 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 9 -0.47 10 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 10 -0.94 11 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 11 -1.28 12 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 12 -0.22 13 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 13 -0.60 14 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 14 -0.26 15 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 15 -0.55 16 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 16 -0.32 17 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 17 -0.47 18 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 18 -0.81 19 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 19 -0.02 20 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 20 -0.68 21 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 21 -0.76 22 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 22 -0.75 23 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 23 -0.33 24 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 24 -0.48 25 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 25 -0.37 26 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 26 -0.64 27 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 27 -0.36 28 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 28 -0.59 29 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 29 -0.17 30 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 30 -0.33 31 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 31 -0.45 32 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 32 -0.50 33 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 33 -0.24 34 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 34 -0.78 35 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 35 -0.55 36 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 36 0.15 37 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 37 -0.16 38 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 38 -0.17 39 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 39 -0.74 40 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 40 -0.51 41 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 41 -0.15 42 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 42 -0.49 43 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 43 -0.46 44 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 44 -0.13 45 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 45 -0.17 46 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 46 -0.82 47 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 47 -0.33 48 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 48 -0.97 49 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 49 -0.18 50 PHE 25 A . ? PHE 17 A PRO 26 A ? PRO 18 A 50 -0.81 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 27 ? PHE A 29 ? PHE A 19 PHE A 21 A 2 ASN A 32 ? TYR A 34 ? ASN A 24 TYR A 26 B 1 TRP A 48 ? ALA A 50 ? TRP A 40 ALA A 42 B 2 TRP A 61 ? PHE A 63 ? TRP A 53 PHE A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 29 ? O PHE A 21 N ASN A 32 ? N ASN A 24 B 1 2 N CYS A 49 ? N CYS A 41 O GLY A 62 ? O GLY A 54 # _pdbx_entry_details.entry_id 1J7M _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.08 2 2 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.07 3 4 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.06 4 5 HE A ARG 34 ? ? O A GLY 37 ? ? 1.53 5 7 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.17 6 8 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.09 7 9 O A PHE 21 ? ? H A GLY 23 ? ? 1.51 8 10 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.11 9 10 HB3 A ALA 42 ? ? HD2 A TYR 47 ? ? 1.28 10 11 HB2 A PRO 57 ? ? H A ASP 58 ? ? 1.32 11 12 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.12 12 12 O A PHE 21 ? ? H A GLY 23 ? ? 1.51 13 15 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.10 14 17 HE1 A PHE 17 ? ? HE1 A PHE 19 ? ? 1.32 15 19 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.13 16 20 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.27 17 21 HE1 A PHE 17 ? ? HE1 A PHE 19 ? ? 1.33 18 25 HE1 A PHE 17 ? ? HE1 A PHE 19 ? ? 1.33 19 26 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.29 20 29 HE1 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.32 21 31 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.17 22 32 HE1 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.30 23 32 HB2 A PRO 57 ? ? H A ASP 58 ? ? 1.30 24 33 HE1 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.24 25 34 HE1 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.29 26 38 O A PHE 21 ? ? H A GLY 23 ? ? 1.49 27 39 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.16 28 39 HE1 A PHE 17 ? ? HE1 A PHE 19 ? ? 1.35 29 40 O A PHE 21 ? ? H A ASN 24 ? ? 1.59 30 42 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.19 31 43 HE1 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.31 32 46 HE2 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.07 33 48 O A PHE 21 ? ? H A GLY 23 ? ? 1.53 34 50 HE1 A TYR 47 ? ? HB3 A TRP 53 ? ? 1.30 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 9 ? ? -156.22 17.24 2 1 ASP A 36 ? ? -103.32 -79.84 3 1 ASP A 49 ? ? -90.88 -64.18 4 1 PRO A 57 ? ? -71.88 -149.63 5 2 VAL A 6 ? ? -113.15 -168.04 6 2 LEU A 22 ? ? 35.63 44.06 7 2 ARG A 34 ? ? -112.04 -78.59 8 3 SER A 4 ? ? 46.36 -150.64 9 3 VAL A 6 ? ? -114.21 -165.17 10 3 ASN A 9 ? ? -148.24 -21.22 11 3 LEU A 22 ? ? 39.46 33.92 12 3 ARG A 34 ? ? -106.70 -72.92 13 3 PRO A 57 ? ? -63.65 -146.00 14 4 TRP A 2 ? ? -106.39 60.14 15 4 VAL A 6 ? ? -117.89 -167.26 16 4 ASN A 9 ? ? -161.80 34.63 17 4 LEU A 22 ? ? 34.68 47.18 18 4 ARG A 34 ? ? -110.44 -81.33 19 4 PRO A 57 ? ? -70.40 -150.86 20 5 SER A 4 ? ? 63.71 -159.88 21 5 ASN A 9 ? ? -153.16 31.93 22 5 PHE A 19 ? ? -103.09 -169.66 23 5 SER A 35 ? ? 78.53 -59.50 24 5 ASP A 36 ? ? -127.00 -106.13 25 5 LYS A 38 ? ? 66.67 145.64 26 5 PRO A 57 ? ? -71.12 -146.56 27 6 TRP A 2 ? ? 62.48 -145.68 28 6 ASN A 9 ? ? -131.73 -30.87 29 6 LEU A 22 ? ? 39.24 36.88 30 6 ASP A 36 ? ? -104.92 -79.18 31 6 ASP A 58 ? ? 29.18 66.71 32 6 GLN A 59 ? ? -122.88 -68.82 33 7 TRP A 2 ? ? -76.54 -88.86 34 7 PHE A 19 ? ? -101.93 -168.02 35 7 ARG A 34 ? ? -100.84 -78.67 36 7 ASP A 49 ? ? -87.48 -70.60 37 7 PRO A 57 ? ? -69.77 4.97 38 8 TRP A 2 ? ? -114.59 -109.51 39 8 VAL A 6 ? ? -116.50 -164.96 40 8 ASN A 9 ? ? -158.75 31.61 41 8 LEU A 22 ? ? 33.28 45.45 42 8 ARG A 34 ? ? -108.04 -64.71 43 8 ASP A 36 ? ? -101.72 -84.32 44 8 PRO A 57 ? ? -65.63 2.59 45 8 GLN A 59 ? ? -99.68 47.63 46 9 VAL A 6 ? ? -124.57 -50.10 47 9 LEU A 22 ? ? -52.93 45.60 48 9 ASP A 36 ? ? -94.60 -83.75 49 9 ASP A 49 ? ? -91.29 -67.88 50 9 PRO A 57 ? ? -73.61 -142.01 51 10 ASN A 9 ? ? -141.82 17.61 52 10 LEU A 22 ? ? 36.19 46.76 53 10 ARG A 34 ? ? -96.25 -80.76 54 10 ASP A 49 ? ? -76.57 -71.42 55 10 PRO A 57 ? ? -67.39 -144.42 56 10 ASP A 58 ? ? -48.03 106.62 57 11 TRP A 2 ? ? 65.01 105.63 58 11 VAL A 6 ? ? -127.80 -168.24 59 11 SER A 10 ? ? -95.98 44.82 60 11 LEU A 22 ? ? 40.91 27.94 61 11 ASP A 36 ? ? -98.72 -85.81 62 11 TRP A 40 ? ? -128.75 -167.37 63 11 ASP A 49 ? ? -85.55 -71.20 64 11 PRO A 57 ? ? -58.70 -131.33 65 11 ASP A 58 ? ? -50.85 109.46 66 12 ASN A 9 ? ? -143.70 27.84 67 12 SER A 10 ? ? -107.76 -65.47 68 12 LEU A 22 ? ? -56.29 43.46 69 12 ASP A 36 ? ? -99.98 -86.40 70 12 ASP A 49 ? ? -93.23 -63.91 71 12 PRO A 57 ? ? -71.46 -150.28 72 13 ASN A 9 ? ? -144.40 -26.70 73 13 ARG A 34 ? ? -101.03 -166.75 74 13 SER A 35 ? ? -144.70 -24.68 75 13 ASP A 36 ? ? -93.17 -89.32 76 14 TRP A 2 ? ? -64.49 -76.52 77 14 ASN A 9 ? ? -161.75 33.91 78 14 ARG A 34 ? ? -110.86 -73.59 79 14 ARG A 51 ? ? 33.35 64.68 80 14 PRO A 57 ? ? -69.18 -153.39 81 15 ASN A 9 ? ? -140.13 29.11 82 15 ASP A 36 ? ? 64.59 -27.40 83 15 ASP A 49 ? ? -95.12 -60.79 84 15 PRO A 57 ? ? -67.70 -146.95 85 15 ASP A 58 ? ? -50.06 108.70 86 16 VAL A 6 ? ? -106.37 -67.96 87 16 ASN A 9 ? ? -160.76 44.78 88 16 LEU A 22 ? ? 37.25 37.06 89 16 ASP A 36 ? ? -93.87 -85.88 90 16 ASP A 58 ? ? 34.35 56.52 91 16 GLN A 59 ? ? -99.74 40.67 92 17 MET A 3 ? ? -91.89 36.16 93 17 VAL A 6 ? ? -112.87 -152.89 94 17 ASN A 9 ? ? -154.19 10.13 95 17 SER A 31 ? ? -141.07 18.62 96 17 ARG A 34 ? ? -107.57 -76.12 97 17 ASP A 36 ? ? -112.14 -88.10 98 17 LYS A 38 ? ? -64.63 -158.43 99 17 ARG A 51 ? ? 39.63 52.45 100 17 PRO A 57 ? ? -78.43 -159.24 101 18 TRP A 2 ? ? -97.44 -137.42 102 18 VAL A 6 ? ? -116.78 -168.23 103 18 ASN A 9 ? ? -145.89 -0.31 104 18 SER A 10 ? ? -91.39 -63.82 105 18 ARG A 34 ? ? -111.21 -71.73 106 18 ASP A 36 ? ? -100.25 -63.41 107 18 TRP A 40 ? ? -128.31 -165.11 108 18 ARG A 51 ? ? 38.55 51.90 109 19 VAL A 6 ? ? -113.77 -166.54 110 19 LEU A 22 ? ? 35.28 45.11 111 19 ARG A 34 ? ? -108.85 -79.16 112 19 ASP A 49 ? ? -90.08 -71.55 113 19 GLN A 59 ? ? -126.80 -149.12 114 20 TRP A 2 ? ? -103.54 76.75 115 20 ASN A 9 ? ? -158.16 28.07 116 20 LEU A 22 ? ? 34.62 47.53 117 20 ARG A 34 ? ? -106.50 -81.99 118 20 TRP A 40 ? ? -128.59 -169.61 119 20 PRO A 57 ? ? -64.18 -143.71 120 20 GLN A 59 ? ? -129.47 -55.49 121 21 VAL A 6 ? ? -110.07 -163.44 122 21 ASN A 9 ? ? -144.23 -31.89 123 21 ASP A 36 ? ? -90.08 -82.96 124 21 ALA A 45 ? ? 70.01 -35.99 125 22 SER A 4 ? ? 67.51 -169.26 126 22 ARG A 34 ? ? -101.72 -158.45 127 22 SER A 35 ? ? -133.34 -40.67 128 22 ASP A 36 ? ? -98.11 -93.20 129 22 GLN A 59 ? ? -104.62 -135.05 130 23 TRP A 2 ? ? 64.64 -86.00 131 23 ASN A 9 ? ? -160.00 41.82 132 23 ASP A 36 ? ? -91.48 -92.55 133 23 GLN A 59 ? ? -113.43 57.95 134 24 MET A 3 ? ? -77.84 -167.57 135 24 SER A 4 ? ? -79.18 -162.82 136 24 LEU A 22 ? ? 38.17 35.02 137 24 ASP A 36 ? ? -108.21 -96.17 138 24 ASP A 49 ? ? -85.04 -71.15 139 24 PRO A 57 ? ? -68.60 -148.33 140 25 TRP A 2 ? ? 71.45 130.15 141 25 MET A 3 ? ? -102.14 51.53 142 25 SER A 4 ? ? 71.28 -167.36 143 25 VAL A 6 ? ? -105.05 -166.31 144 25 ASN A 9 ? ? -148.06 -26.94 145 25 ARG A 34 ? ? -114.35 -81.28 146 25 ARG A 51 ? ? 38.04 55.97 147 25 PRO A 57 ? ? -63.92 2.80 148 25 ASP A 58 ? ? 63.94 150.11 149 26 LEU A 22 ? ? 34.25 44.62 150 26 ASP A 36 ? ? -96.51 -78.23 151 27 ARG A 34 ? ? -105.58 -72.02 152 28 MET A 3 ? ? -106.73 45.89 153 28 VAL A 6 ? ? -127.49 -166.69 154 28 ASN A 9 ? ? -133.48 -31.71 155 28 LEU A 22 ? ? 34.08 47.49 156 28 ARG A 34 ? ? -105.35 -65.74 157 28 ASP A 36 ? ? -92.67 -71.34 158 28 PRO A 57 ? ? -74.31 -152.20 159 29 ASN A 9 ? ? -150.61 30.19 160 29 LEU A 22 ? ? 35.87 49.03 161 29 ARG A 34 ? ? -109.73 -92.04 162 29 TRP A 40 ? ? -129.11 -167.38 163 29 PRO A 57 ? ? -74.25 -157.09 164 30 SER A 4 ? ? -108.86 -158.41 165 30 ASN A 9 ? ? -140.50 -98.46 166 30 SER A 10 ? ? 34.41 31.99 167 30 LEU A 22 ? ? 38.88 35.16 168 30 ARG A 34 ? ? -109.49 -75.97 169 30 ASP A 49 ? ? -92.97 -63.94 170 30 PRO A 57 ? ? -73.03 -163.45 171 30 ASP A 58 ? ? 34.04 63.40 172 31 VAL A 6 ? ? -121.72 -164.50 173 31 ASN A 9 ? ? -143.79 -11.18 174 31 LEU A 22 ? ? 32.61 47.76 175 31 ASP A 36 ? ? -108.13 -88.84 176 31 TRP A 40 ? ? -125.12 -161.28 177 31 ASP A 49 ? ? -90.79 -63.74 178 31 ARG A 51 ? ? 34.74 56.30 179 31 PRO A 57 ? ? -71.11 -146.40 180 31 GLN A 59 ? ? -108.12 -154.14 181 32 MET A 3 ? ? -94.69 -121.18 182 32 SER A 4 ? ? -49.51 156.99 183 32 ASN A 9 ? ? -141.21 -4.81 184 32 SER A 10 ? ? -95.07 52.28 185 32 LEU A 22 ? ? 37.00 49.23 186 32 ARG A 34 ? ? -107.71 -77.28 187 32 ASP A 36 ? ? -112.63 -84.13 188 32 PRO A 57 ? ? -30.37 -111.44 189 32 GLN A 59 ? ? -109.07 -77.80 190 33 LEU A 22 ? ? 35.10 46.92 191 33 ASP A 36 ? ? -89.95 -76.81 192 33 ASP A 49 ? ? -82.52 -77.99 193 33 PRO A 57 ? ? -68.78 -149.88 194 33 GLN A 59 ? ? -108.15 -120.22 195 34 ASN A 9 ? ? -148.14 19.02 196 34 LEU A 22 ? ? 33.36 45.41 197 34 ASP A 36 ? ? -91.67 -85.81 198 34 PRO A 57 ? ? -64.48 -113.93 199 34 ASP A 58 ? ? -58.21 104.15 200 35 TRP A 2 ? ? 72.55 148.36 201 35 VAL A 6 ? ? -113.67 -166.93 202 35 ASN A 9 ? ? -154.51 27.67 203 35 LEU A 22 ? ? 38.06 36.32 204 35 ASP A 36 ? ? -93.32 -82.85 205 35 LYS A 38 ? ? -62.04 98.91 206 35 TRP A 40 ? ? -129.08 -165.96 207 35 ASP A 49 ? ? -86.57 -76.80 208 35 ARG A 51 ? ? 39.24 54.60 209 35 PRO A 57 ? ? -65.63 -143.49 210 35 ASP A 58 ? ? -63.16 85.56 211 36 MET A 3 ? ? -50.14 104.89 212 36 ASN A 9 ? ? -155.63 20.67 213 36 LEU A 22 ? ? 39.95 32.62 214 36 ASP A 36 ? ? -93.77 -77.80 215 36 PRO A 57 ? ? -70.02 -146.18 216 36 ASP A 58 ? ? -56.00 108.24 217 37 TRP A 2 ? ? 64.20 99.54 218 37 SER A 4 ? ? 42.70 -134.60 219 37 ASN A 9 ? ? -156.82 29.16 220 37 LEU A 22 ? ? 39.38 38.96 221 37 ASP A 36 ? ? -88.08 -83.78 222 37 PRO A 57 ? ? -60.45 -143.64 223 38 SER A 10 ? ? -99.55 32.60 224 38 PHE A 21 ? ? -104.44 -140.36 225 38 LEU A 22 ? ? -49.67 52.81 226 38 ASP A 36 ? ? -104.13 -79.20 227 39 SER A 4 ? ? 61.02 -167.67 228 39 ASN A 9 ? ? -156.01 28.72 229 39 PHE A 19 ? ? -105.10 -169.03 230 39 LEU A 22 ? ? 33.92 45.18 231 39 TRP A 40 ? ? -121.85 -163.60 232 40 ASN A 9 ? ? -159.23 40.50 233 40 SER A 10 ? ? -77.85 -75.46 234 40 LEU A 22 ? ? 26.26 52.75 235 40 ARG A 34 ? ? -111.46 -82.20 236 41 MET A 3 ? ? -59.91 98.25 237 41 ASN A 9 ? ? -141.89 -103.78 238 41 SER A 10 ? ? 39.37 15.40 239 41 LEU A 22 ? ? 39.33 38.20 240 41 ARG A 34 ? ? -103.20 -69.52 241 42 ASN A 9 ? ? -149.66 29.95 242 42 LEU A 22 ? ? 35.85 46.08 243 42 ASP A 36 ? ? -100.98 -88.00 244 43 TRP A 2 ? ? 57.99 -92.93 245 43 VAL A 6 ? ? -122.60 -53.22 246 43 LEU A 22 ? ? 33.74 45.09 247 43 SER A 35 ? ? -146.39 15.47 248 43 ASP A 36 ? ? -97.79 -81.15 249 43 PRO A 57 ? ? -70.13 -147.66 250 43 GLN A 59 ? ? -103.56 -70.28 251 44 VAL A 6 ? ? -118.84 -166.80 252 44 ASN A 9 ? ? -156.38 30.83 253 44 LEU A 22 ? ? 39.28 36.59 254 44 ARG A 34 ? ? -103.51 -74.43 255 44 PRO A 57 ? ? -73.38 -149.25 256 45 MET A 3 ? ? -94.17 42.37 257 45 VAL A 6 ? ? -129.18 -160.47 258 45 LEU A 22 ? ? 39.51 37.40 259 45 ARG A 34 ? ? -108.73 -82.40 260 45 PRO A 57 ? ? -68.56 -152.35 261 46 VAL A 6 ? ? -107.94 -168.13 262 46 ASN A 9 ? ? -157.03 24.34 263 46 PHE A 19 ? ? -103.02 -169.88 264 46 LEU A 22 ? ? 35.38 48.28 265 46 ASP A 36 ? ? -102.42 -86.16 266 46 TRP A 40 ? ? -129.99 -162.78 267 47 LEU A 22 ? ? 38.37 39.54 268 47 ASP A 36 ? ? -90.64 -84.68 269 47 ASP A 49 ? ? -84.87 -72.23 270 48 MET A 3 ? ? -66.56 83.27 271 48 ASN A 9 ? ? -141.97 -4.03 272 48 PHE A 21 ? ? -111.11 -143.73 273 48 LEU A 22 ? ? -49.11 55.15 274 48 ASP A 36 ? ? -107.29 -90.81 275 48 ASP A 49 ? ? -78.00 -74.49 276 48 PRO A 57 ? ? -76.05 -147.78 277 48 ASP A 58 ? ? -54.25 105.41 278 49 TRP A 2 ? ? -111.32 55.32 279 49 VAL A 6 ? ? -107.43 -168.10 280 49 ASN A 9 ? ? -154.54 12.17 281 49 LEU A 22 ? ? 39.58 32.88 282 49 ASP A 36 ? ? -95.12 -85.15 283 49 GLN A 59 ? ? -137.14 -86.87 284 50 VAL A 6 ? ? -106.46 -166.26 285 50 ASN A 9 ? ? -168.36 37.06 286 50 LEU A 22 ? ? 35.27 46.42 287 50 ASP A 36 ? ? -87.65 -81.70 288 50 TRP A 40 ? ? -128.20 -166.98 289 50 ASP A 58 ? ? 36.88 63.14 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 9 PHE A 21 ? ? 0.081 'SIDE CHAIN' 2 40 PHE A 21 ? ? 0.074 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1J7M _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 50 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1J7M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.5mM col-3 NA; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '0.5mM col-3 NA; D2O' D2O 3 '1mM col-3 U-15n; 90% H2O, 10% D2O' '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D COSY' 1 2 1 '2D TOCSY' 1 3 1 '2D NOESY' # _pdbx_nmr_refine.entry_id 1J7M _pdbx_nmr_refine.method 'distance geometry and simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.0 collection 'Bruker, Germany' 1 Felix 95 processing 'Molecular Simulations, Inc. San Diego, CA' 2 Felix 95 'data analysis' 'Molecular Simulations, Inc San Diego, CA' 3 X-PLOR 3.851 'structure solution' Brunger 4 X-PLOR 3.851 refinement Brunger 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU -7 ? A LEU 1 2 1 Y 1 A ALA -6 ? A ALA 2 3 1 Y 1 A ALA -5 ? A ALA 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A PRO -3 ? A PRO 5 6 1 Y 1 A PRO -2 ? A PRO 6 7 1 Y 1 A PHE -1 ? A PHE 7 8 1 Y 1 A ALA 0 ? A ALA 8 9 1 Y 1 A TRP 61 ? A TRP 69 10 1 Y 1 A ILE 62 ? A ILE 70 11 1 Y 1 A SER 63 ? A SER 71 12 1 Y 1 A SER 64 ? A SER 72 13 2 Y 1 A LEU -7 ? A LEU 1 14 2 Y 1 A ALA -6 ? A ALA 2 15 2 Y 1 A ALA -5 ? A ALA 3 16 2 Y 1 A HIS -4 ? A HIS 4 17 2 Y 1 A PRO -3 ? A PRO 5 18 2 Y 1 A PRO -2 ? A PRO 6 19 2 Y 1 A PHE -1 ? A PHE 7 20 2 Y 1 A ALA 0 ? A ALA 8 21 2 Y 1 A TRP 61 ? A TRP 69 22 2 Y 1 A ILE 62 ? A ILE 70 23 2 Y 1 A SER 63 ? A SER 71 24 2 Y 1 A SER 64 ? A SER 72 25 3 Y 1 A LEU -7 ? A LEU 1 26 3 Y 1 A ALA -6 ? A ALA 2 27 3 Y 1 A ALA -5 ? A ALA 3 28 3 Y 1 A HIS -4 ? A HIS 4 29 3 Y 1 A PRO -3 ? A PRO 5 30 3 Y 1 A PRO -2 ? A PRO 6 31 3 Y 1 A PHE -1 ? A PHE 7 32 3 Y 1 A ALA 0 ? A ALA 8 33 3 Y 1 A TRP 61 ? A TRP 69 34 3 Y 1 A ILE 62 ? A ILE 70 35 3 Y 1 A SER 63 ? A SER 71 36 3 Y 1 A SER 64 ? A SER 72 37 4 Y 1 A LEU -7 ? A LEU 1 38 4 Y 1 A ALA -6 ? A ALA 2 39 4 Y 1 A ALA -5 ? A ALA 3 40 4 Y 1 A HIS -4 ? A HIS 4 41 4 Y 1 A PRO -3 ? A PRO 5 42 4 Y 1 A PRO -2 ? A PRO 6 43 4 Y 1 A PHE -1 ? A PHE 7 44 4 Y 1 A ALA 0 ? A ALA 8 45 4 Y 1 A TRP 61 ? A TRP 69 46 4 Y 1 A ILE 62 ? A ILE 70 47 4 Y 1 A SER 63 ? A SER 71 48 4 Y 1 A SER 64 ? A SER 72 49 5 Y 1 A LEU -7 ? A LEU 1 50 5 Y 1 A ALA -6 ? A ALA 2 51 5 Y 1 A ALA -5 ? A ALA 3 52 5 Y 1 A HIS -4 ? A HIS 4 53 5 Y 1 A PRO -3 ? A PRO 5 54 5 Y 1 A PRO -2 ? A PRO 6 55 5 Y 1 A PHE -1 ? A PHE 7 56 5 Y 1 A ALA 0 ? A ALA 8 57 5 Y 1 A TRP 61 ? A TRP 69 58 5 Y 1 A ILE 62 ? A ILE 70 59 5 Y 1 A SER 63 ? A SER 71 60 5 Y 1 A SER 64 ? A SER 72 61 6 Y 1 A LEU -7 ? A LEU 1 62 6 Y 1 A ALA -6 ? A ALA 2 63 6 Y 1 A ALA -5 ? A ALA 3 64 6 Y 1 A HIS -4 ? A HIS 4 65 6 Y 1 A PRO -3 ? A PRO 5 66 6 Y 1 A PRO -2 ? A PRO 6 67 6 Y 1 A PHE -1 ? A PHE 7 68 6 Y 1 A ALA 0 ? A ALA 8 69 6 Y 1 A TRP 61 ? A TRP 69 70 6 Y 1 A ILE 62 ? A ILE 70 71 6 Y 1 A SER 63 ? A SER 71 72 6 Y 1 A SER 64 ? A SER 72 73 7 Y 1 A LEU -7 ? A LEU 1 74 7 Y 1 A ALA -6 ? A ALA 2 75 7 Y 1 A ALA -5 ? A ALA 3 76 7 Y 1 A HIS -4 ? A HIS 4 77 7 Y 1 A PRO -3 ? A PRO 5 78 7 Y 1 A PRO -2 ? A PRO 6 79 7 Y 1 A PHE -1 ? A PHE 7 80 7 Y 1 A ALA 0 ? A ALA 8 81 7 Y 1 A TRP 61 ? A TRP 69 82 7 Y 1 A ILE 62 ? A ILE 70 83 7 Y 1 A SER 63 ? A SER 71 84 7 Y 1 A SER 64 ? A SER 72 85 8 Y 1 A LEU -7 ? A LEU 1 86 8 Y 1 A ALA -6 ? A ALA 2 87 8 Y 1 A ALA -5 ? A ALA 3 88 8 Y 1 A HIS -4 ? A HIS 4 89 8 Y 1 A PRO -3 ? A PRO 5 90 8 Y 1 A PRO -2 ? A PRO 6 91 8 Y 1 A PHE -1 ? A PHE 7 92 8 Y 1 A ALA 0 ? A ALA 8 93 8 Y 1 A TRP 61 ? A TRP 69 94 8 Y 1 A ILE 62 ? A ILE 70 95 8 Y 1 A SER 63 ? A SER 71 96 8 Y 1 A SER 64 ? A SER 72 97 9 Y 1 A LEU -7 ? A LEU 1 98 9 Y 1 A ALA -6 ? A ALA 2 99 9 Y 1 A ALA -5 ? A ALA 3 100 9 Y 1 A HIS -4 ? A HIS 4 101 9 Y 1 A PRO -3 ? A PRO 5 102 9 Y 1 A PRO -2 ? A PRO 6 103 9 Y 1 A PHE -1 ? A PHE 7 104 9 Y 1 A ALA 0 ? A ALA 8 105 9 Y 1 A TRP 61 ? A TRP 69 106 9 Y 1 A ILE 62 ? A ILE 70 107 9 Y 1 A SER 63 ? A SER 71 108 9 Y 1 A SER 64 ? A SER 72 109 10 Y 1 A LEU -7 ? A LEU 1 110 10 Y 1 A ALA -6 ? A ALA 2 111 10 Y 1 A ALA -5 ? A ALA 3 112 10 Y 1 A HIS -4 ? A HIS 4 113 10 Y 1 A PRO -3 ? A PRO 5 114 10 Y 1 A PRO -2 ? A PRO 6 115 10 Y 1 A PHE -1 ? A PHE 7 116 10 Y 1 A ALA 0 ? A ALA 8 117 10 Y 1 A TRP 61 ? A TRP 69 118 10 Y 1 A ILE 62 ? A ILE 70 119 10 Y 1 A SER 63 ? A SER 71 120 10 Y 1 A SER 64 ? A SER 72 121 11 Y 1 A LEU -7 ? A LEU 1 122 11 Y 1 A ALA -6 ? A ALA 2 123 11 Y 1 A ALA -5 ? A ALA 3 124 11 Y 1 A HIS -4 ? A HIS 4 125 11 Y 1 A PRO -3 ? A PRO 5 126 11 Y 1 A PRO -2 ? A PRO 6 127 11 Y 1 A PHE -1 ? A PHE 7 128 11 Y 1 A ALA 0 ? A ALA 8 129 11 Y 1 A TRP 61 ? A TRP 69 130 11 Y 1 A ILE 62 ? A ILE 70 131 11 Y 1 A SER 63 ? A SER 71 132 11 Y 1 A SER 64 ? A SER 72 133 12 Y 1 A LEU -7 ? A LEU 1 134 12 Y 1 A ALA -6 ? A ALA 2 135 12 Y 1 A ALA -5 ? A ALA 3 136 12 Y 1 A HIS -4 ? A HIS 4 137 12 Y 1 A PRO -3 ? A PRO 5 138 12 Y 1 A PRO -2 ? A PRO 6 139 12 Y 1 A PHE -1 ? A PHE 7 140 12 Y 1 A ALA 0 ? A ALA 8 141 12 Y 1 A TRP 61 ? A TRP 69 142 12 Y 1 A ILE 62 ? A ILE 70 143 12 Y 1 A SER 63 ? A SER 71 144 12 Y 1 A SER 64 ? A SER 72 145 13 Y 1 A LEU -7 ? A LEU 1 146 13 Y 1 A ALA -6 ? A ALA 2 147 13 Y 1 A ALA -5 ? A ALA 3 148 13 Y 1 A HIS -4 ? A HIS 4 149 13 Y 1 A PRO -3 ? A PRO 5 150 13 Y 1 A PRO -2 ? A PRO 6 151 13 Y 1 A PHE -1 ? A PHE 7 152 13 Y 1 A ALA 0 ? A ALA 8 153 13 Y 1 A TRP 61 ? A TRP 69 154 13 Y 1 A ILE 62 ? A ILE 70 155 13 Y 1 A SER 63 ? A SER 71 156 13 Y 1 A SER 64 ? A SER 72 157 14 Y 1 A LEU -7 ? A LEU 1 158 14 Y 1 A ALA -6 ? A ALA 2 159 14 Y 1 A ALA -5 ? A ALA 3 160 14 Y 1 A HIS -4 ? A HIS 4 161 14 Y 1 A PRO -3 ? A PRO 5 162 14 Y 1 A PRO -2 ? A PRO 6 163 14 Y 1 A PHE -1 ? A PHE 7 164 14 Y 1 A ALA 0 ? A ALA 8 165 14 Y 1 A TRP 61 ? A TRP 69 166 14 Y 1 A ILE 62 ? A ILE 70 167 14 Y 1 A SER 63 ? A SER 71 168 14 Y 1 A SER 64 ? A SER 72 169 15 Y 1 A LEU -7 ? A LEU 1 170 15 Y 1 A ALA -6 ? A ALA 2 171 15 Y 1 A ALA -5 ? A ALA 3 172 15 Y 1 A HIS -4 ? A HIS 4 173 15 Y 1 A PRO -3 ? A PRO 5 174 15 Y 1 A PRO -2 ? A PRO 6 175 15 Y 1 A PHE -1 ? A PHE 7 176 15 Y 1 A ALA 0 ? A ALA 8 177 15 Y 1 A TRP 61 ? A TRP 69 178 15 Y 1 A ILE 62 ? A ILE 70 179 15 Y 1 A SER 63 ? A SER 71 180 15 Y 1 A SER 64 ? A SER 72 181 16 Y 1 A LEU -7 ? A LEU 1 182 16 Y 1 A ALA -6 ? A ALA 2 183 16 Y 1 A ALA -5 ? A ALA 3 184 16 Y 1 A HIS -4 ? A HIS 4 185 16 Y 1 A PRO -3 ? A PRO 5 186 16 Y 1 A PRO -2 ? A PRO 6 187 16 Y 1 A PHE -1 ? A PHE 7 188 16 Y 1 A ALA 0 ? A ALA 8 189 16 Y 1 A TRP 61 ? A TRP 69 190 16 Y 1 A ILE 62 ? A ILE 70 191 16 Y 1 A SER 63 ? A SER 71 192 16 Y 1 A SER 64 ? A SER 72 193 17 Y 1 A LEU -7 ? A LEU 1 194 17 Y 1 A ALA -6 ? A ALA 2 195 17 Y 1 A ALA -5 ? A ALA 3 196 17 Y 1 A HIS -4 ? A HIS 4 197 17 Y 1 A PRO -3 ? A PRO 5 198 17 Y 1 A PRO -2 ? A PRO 6 199 17 Y 1 A PHE -1 ? A PHE 7 200 17 Y 1 A ALA 0 ? A ALA 8 201 17 Y 1 A TRP 61 ? A TRP 69 202 17 Y 1 A ILE 62 ? A ILE 70 203 17 Y 1 A SER 63 ? A SER 71 204 17 Y 1 A SER 64 ? A SER 72 205 18 Y 1 A LEU -7 ? A LEU 1 206 18 Y 1 A ALA -6 ? A ALA 2 207 18 Y 1 A ALA -5 ? A ALA 3 208 18 Y 1 A HIS -4 ? A HIS 4 209 18 Y 1 A PRO -3 ? A PRO 5 210 18 Y 1 A PRO -2 ? A PRO 6 211 18 Y 1 A PHE -1 ? A PHE 7 212 18 Y 1 A ALA 0 ? A ALA 8 213 18 Y 1 A TRP 61 ? A TRP 69 214 18 Y 1 A ILE 62 ? A ILE 70 215 18 Y 1 A SER 63 ? A SER 71 216 18 Y 1 A SER 64 ? A SER 72 217 19 Y 1 A LEU -7 ? A LEU 1 218 19 Y 1 A ALA -6 ? A ALA 2 219 19 Y 1 A ALA -5 ? A ALA 3 220 19 Y 1 A HIS -4 ? A HIS 4 221 19 Y 1 A PRO -3 ? A PRO 5 222 19 Y 1 A PRO -2 ? A PRO 6 223 19 Y 1 A PHE -1 ? A PHE 7 224 19 Y 1 A ALA 0 ? A ALA 8 225 19 Y 1 A TRP 61 ? A TRP 69 226 19 Y 1 A ILE 62 ? A ILE 70 227 19 Y 1 A SER 63 ? A SER 71 228 19 Y 1 A SER 64 ? A SER 72 229 20 Y 1 A LEU -7 ? A LEU 1 230 20 Y 1 A ALA -6 ? A ALA 2 231 20 Y 1 A ALA -5 ? A ALA 3 232 20 Y 1 A HIS -4 ? A HIS 4 233 20 Y 1 A PRO -3 ? A PRO 5 234 20 Y 1 A PRO -2 ? A PRO 6 235 20 Y 1 A PHE -1 ? A PHE 7 236 20 Y 1 A ALA 0 ? A ALA 8 237 20 Y 1 A TRP 61 ? A TRP 69 238 20 Y 1 A ILE 62 ? A ILE 70 239 20 Y 1 A SER 63 ? A SER 71 240 20 Y 1 A SER 64 ? A SER 72 241 21 Y 1 A LEU -7 ? A LEU 1 242 21 Y 1 A ALA -6 ? A ALA 2 243 21 Y 1 A ALA -5 ? A ALA 3 244 21 Y 1 A HIS -4 ? A HIS 4 245 21 Y 1 A PRO -3 ? A PRO 5 246 21 Y 1 A PRO -2 ? A PRO 6 247 21 Y 1 A PHE -1 ? A PHE 7 248 21 Y 1 A ALA 0 ? A ALA 8 249 21 Y 1 A TRP 61 ? A TRP 69 250 21 Y 1 A ILE 62 ? A ILE 70 251 21 Y 1 A SER 63 ? A SER 71 252 21 Y 1 A SER 64 ? A SER 72 253 22 Y 1 A LEU -7 ? A LEU 1 254 22 Y 1 A ALA -6 ? A ALA 2 255 22 Y 1 A ALA -5 ? A ALA 3 256 22 Y 1 A HIS -4 ? A HIS 4 257 22 Y 1 A PRO -3 ? A PRO 5 258 22 Y 1 A PRO -2 ? A PRO 6 259 22 Y 1 A PHE -1 ? A PHE 7 260 22 Y 1 A ALA 0 ? A ALA 8 261 22 Y 1 A TRP 61 ? A TRP 69 262 22 Y 1 A ILE 62 ? A ILE 70 263 22 Y 1 A SER 63 ? A SER 71 264 22 Y 1 A SER 64 ? A SER 72 265 23 Y 1 A LEU -7 ? A LEU 1 266 23 Y 1 A ALA -6 ? A ALA 2 267 23 Y 1 A ALA -5 ? A ALA 3 268 23 Y 1 A HIS -4 ? A HIS 4 269 23 Y 1 A PRO -3 ? A PRO 5 270 23 Y 1 A PRO -2 ? A PRO 6 271 23 Y 1 A PHE -1 ? A PHE 7 272 23 Y 1 A ALA 0 ? A ALA 8 273 23 Y 1 A TRP 61 ? A TRP 69 274 23 Y 1 A ILE 62 ? A ILE 70 275 23 Y 1 A SER 63 ? A SER 71 276 23 Y 1 A SER 64 ? A SER 72 277 24 Y 1 A LEU -7 ? A LEU 1 278 24 Y 1 A ALA -6 ? A ALA 2 279 24 Y 1 A ALA -5 ? A ALA 3 280 24 Y 1 A HIS -4 ? A HIS 4 281 24 Y 1 A PRO -3 ? A PRO 5 282 24 Y 1 A PRO -2 ? A PRO 6 283 24 Y 1 A PHE -1 ? A PHE 7 284 24 Y 1 A ALA 0 ? A ALA 8 285 24 Y 1 A TRP 61 ? A TRP 69 286 24 Y 1 A ILE 62 ? A ILE 70 287 24 Y 1 A SER 63 ? A SER 71 288 24 Y 1 A SER 64 ? A SER 72 289 25 Y 1 A LEU -7 ? A LEU 1 290 25 Y 1 A ALA -6 ? A ALA 2 291 25 Y 1 A ALA -5 ? A ALA 3 292 25 Y 1 A HIS -4 ? A HIS 4 293 25 Y 1 A PRO -3 ? A PRO 5 294 25 Y 1 A PRO -2 ? A PRO 6 295 25 Y 1 A PHE -1 ? A PHE 7 296 25 Y 1 A ALA 0 ? A ALA 8 297 25 Y 1 A TRP 61 ? A TRP 69 298 25 Y 1 A ILE 62 ? A ILE 70 299 25 Y 1 A SER 63 ? A SER 71 300 25 Y 1 A SER 64 ? A SER 72 301 26 Y 1 A LEU -7 ? A LEU 1 302 26 Y 1 A ALA -6 ? A ALA 2 303 26 Y 1 A ALA -5 ? A ALA 3 304 26 Y 1 A HIS -4 ? A HIS 4 305 26 Y 1 A PRO -3 ? A PRO 5 306 26 Y 1 A PRO -2 ? A PRO 6 307 26 Y 1 A PHE -1 ? A PHE 7 308 26 Y 1 A ALA 0 ? A ALA 8 309 26 Y 1 A TRP 61 ? A TRP 69 310 26 Y 1 A ILE 62 ? A ILE 70 311 26 Y 1 A SER 63 ? A SER 71 312 26 Y 1 A SER 64 ? A SER 72 313 27 Y 1 A LEU -7 ? A LEU 1 314 27 Y 1 A ALA -6 ? A ALA 2 315 27 Y 1 A ALA -5 ? A ALA 3 316 27 Y 1 A HIS -4 ? A HIS 4 317 27 Y 1 A PRO -3 ? A PRO 5 318 27 Y 1 A PRO -2 ? A PRO 6 319 27 Y 1 A PHE -1 ? A PHE 7 320 27 Y 1 A ALA 0 ? A ALA 8 321 27 Y 1 A TRP 61 ? A TRP 69 322 27 Y 1 A ILE 62 ? A ILE 70 323 27 Y 1 A SER 63 ? A SER 71 324 27 Y 1 A SER 64 ? A SER 72 325 28 Y 1 A LEU -7 ? A LEU 1 326 28 Y 1 A ALA -6 ? A ALA 2 327 28 Y 1 A ALA -5 ? A ALA 3 328 28 Y 1 A HIS -4 ? A HIS 4 329 28 Y 1 A PRO -3 ? A PRO 5 330 28 Y 1 A PRO -2 ? A PRO 6 331 28 Y 1 A PHE -1 ? A PHE 7 332 28 Y 1 A ALA 0 ? A ALA 8 333 28 Y 1 A TRP 61 ? A TRP 69 334 28 Y 1 A ILE 62 ? A ILE 70 335 28 Y 1 A SER 63 ? A SER 71 336 28 Y 1 A SER 64 ? A SER 72 337 29 Y 1 A LEU -7 ? A LEU 1 338 29 Y 1 A ALA -6 ? A ALA 2 339 29 Y 1 A ALA -5 ? A ALA 3 340 29 Y 1 A HIS -4 ? A HIS 4 341 29 Y 1 A PRO -3 ? A PRO 5 342 29 Y 1 A PRO -2 ? A PRO 6 343 29 Y 1 A PHE -1 ? A PHE 7 344 29 Y 1 A ALA 0 ? A ALA 8 345 29 Y 1 A TRP 61 ? A TRP 69 346 29 Y 1 A ILE 62 ? A ILE 70 347 29 Y 1 A SER 63 ? A SER 71 348 29 Y 1 A SER 64 ? A SER 72 349 30 Y 1 A LEU -7 ? A LEU 1 350 30 Y 1 A ALA -6 ? A ALA 2 351 30 Y 1 A ALA -5 ? A ALA 3 352 30 Y 1 A HIS -4 ? A HIS 4 353 30 Y 1 A PRO -3 ? A PRO 5 354 30 Y 1 A PRO -2 ? A PRO 6 355 30 Y 1 A PHE -1 ? A PHE 7 356 30 Y 1 A ALA 0 ? A ALA 8 357 30 Y 1 A TRP 61 ? A TRP 69 358 30 Y 1 A ILE 62 ? A ILE 70 359 30 Y 1 A SER 63 ? A SER 71 360 30 Y 1 A SER 64 ? A SER 72 361 31 Y 1 A LEU -7 ? A LEU 1 362 31 Y 1 A ALA -6 ? A ALA 2 363 31 Y 1 A ALA -5 ? A ALA 3 364 31 Y 1 A HIS -4 ? A HIS 4 365 31 Y 1 A PRO -3 ? A PRO 5 366 31 Y 1 A PRO -2 ? A PRO 6 367 31 Y 1 A PHE -1 ? A PHE 7 368 31 Y 1 A ALA 0 ? A ALA 8 369 31 Y 1 A TRP 61 ? A TRP 69 370 31 Y 1 A ILE 62 ? A ILE 70 371 31 Y 1 A SER 63 ? A SER 71 372 31 Y 1 A SER 64 ? A SER 72 373 32 Y 1 A LEU -7 ? A LEU 1 374 32 Y 1 A ALA -6 ? A ALA 2 375 32 Y 1 A ALA -5 ? A ALA 3 376 32 Y 1 A HIS -4 ? A HIS 4 377 32 Y 1 A PRO -3 ? A PRO 5 378 32 Y 1 A PRO -2 ? A PRO 6 379 32 Y 1 A PHE -1 ? A PHE 7 380 32 Y 1 A ALA 0 ? A ALA 8 381 32 Y 1 A TRP 61 ? A TRP 69 382 32 Y 1 A ILE 62 ? A ILE 70 383 32 Y 1 A SER 63 ? A SER 71 384 32 Y 1 A SER 64 ? A SER 72 385 33 Y 1 A LEU -7 ? A LEU 1 386 33 Y 1 A ALA -6 ? A ALA 2 387 33 Y 1 A ALA -5 ? A ALA 3 388 33 Y 1 A HIS -4 ? A HIS 4 389 33 Y 1 A PRO -3 ? A PRO 5 390 33 Y 1 A PRO -2 ? A PRO 6 391 33 Y 1 A PHE -1 ? A PHE 7 392 33 Y 1 A ALA 0 ? A ALA 8 393 33 Y 1 A TRP 61 ? A TRP 69 394 33 Y 1 A ILE 62 ? A ILE 70 395 33 Y 1 A SER 63 ? A SER 71 396 33 Y 1 A SER 64 ? A SER 72 397 34 Y 1 A LEU -7 ? A LEU 1 398 34 Y 1 A ALA -6 ? A ALA 2 399 34 Y 1 A ALA -5 ? A ALA 3 400 34 Y 1 A HIS -4 ? A HIS 4 401 34 Y 1 A PRO -3 ? A PRO 5 402 34 Y 1 A PRO -2 ? A PRO 6 403 34 Y 1 A PHE -1 ? A PHE 7 404 34 Y 1 A ALA 0 ? A ALA 8 405 34 Y 1 A TRP 61 ? A TRP 69 406 34 Y 1 A ILE 62 ? A ILE 70 407 34 Y 1 A SER 63 ? A SER 71 408 34 Y 1 A SER 64 ? A SER 72 409 35 Y 1 A LEU -7 ? A LEU 1 410 35 Y 1 A ALA -6 ? A ALA 2 411 35 Y 1 A ALA -5 ? A ALA 3 412 35 Y 1 A HIS -4 ? A HIS 4 413 35 Y 1 A PRO -3 ? A PRO 5 414 35 Y 1 A PRO -2 ? A PRO 6 415 35 Y 1 A PHE -1 ? A PHE 7 416 35 Y 1 A ALA 0 ? A ALA 8 417 35 Y 1 A TRP 61 ? A TRP 69 418 35 Y 1 A ILE 62 ? A ILE 70 419 35 Y 1 A SER 63 ? A SER 71 420 35 Y 1 A SER 64 ? A SER 72 421 36 Y 1 A LEU -7 ? A LEU 1 422 36 Y 1 A ALA -6 ? A ALA 2 423 36 Y 1 A ALA -5 ? A ALA 3 424 36 Y 1 A HIS -4 ? A HIS 4 425 36 Y 1 A PRO -3 ? A PRO 5 426 36 Y 1 A PRO -2 ? A PRO 6 427 36 Y 1 A PHE -1 ? A PHE 7 428 36 Y 1 A ALA 0 ? A ALA 8 429 36 Y 1 A TRP 61 ? A TRP 69 430 36 Y 1 A ILE 62 ? A ILE 70 431 36 Y 1 A SER 63 ? A SER 71 432 36 Y 1 A SER 64 ? A SER 72 433 37 Y 1 A LEU -7 ? A LEU 1 434 37 Y 1 A ALA -6 ? A ALA 2 435 37 Y 1 A ALA -5 ? A ALA 3 436 37 Y 1 A HIS -4 ? A HIS 4 437 37 Y 1 A PRO -3 ? A PRO 5 438 37 Y 1 A PRO -2 ? A PRO 6 439 37 Y 1 A PHE -1 ? A PHE 7 440 37 Y 1 A ALA 0 ? A ALA 8 441 37 Y 1 A TRP 61 ? A TRP 69 442 37 Y 1 A ILE 62 ? A ILE 70 443 37 Y 1 A SER 63 ? A SER 71 444 37 Y 1 A SER 64 ? A SER 72 445 38 Y 1 A LEU -7 ? A LEU 1 446 38 Y 1 A ALA -6 ? A ALA 2 447 38 Y 1 A ALA -5 ? A ALA 3 448 38 Y 1 A HIS -4 ? A HIS 4 449 38 Y 1 A PRO -3 ? A PRO 5 450 38 Y 1 A PRO -2 ? A PRO 6 451 38 Y 1 A PHE -1 ? A PHE 7 452 38 Y 1 A ALA 0 ? A ALA 8 453 38 Y 1 A TRP 61 ? A TRP 69 454 38 Y 1 A ILE 62 ? A ILE 70 455 38 Y 1 A SER 63 ? A SER 71 456 38 Y 1 A SER 64 ? A SER 72 457 39 Y 1 A LEU -7 ? A LEU 1 458 39 Y 1 A ALA -6 ? A ALA 2 459 39 Y 1 A ALA -5 ? A ALA 3 460 39 Y 1 A HIS -4 ? A HIS 4 461 39 Y 1 A PRO -3 ? A PRO 5 462 39 Y 1 A PRO -2 ? A PRO 6 463 39 Y 1 A PHE -1 ? A PHE 7 464 39 Y 1 A ALA 0 ? A ALA 8 465 39 Y 1 A TRP 61 ? A TRP 69 466 39 Y 1 A ILE 62 ? A ILE 70 467 39 Y 1 A SER 63 ? A SER 71 468 39 Y 1 A SER 64 ? A SER 72 469 40 Y 1 A LEU -7 ? A LEU 1 470 40 Y 1 A ALA -6 ? A ALA 2 471 40 Y 1 A ALA -5 ? A ALA 3 472 40 Y 1 A HIS -4 ? A HIS 4 473 40 Y 1 A PRO -3 ? A PRO 5 474 40 Y 1 A PRO -2 ? A PRO 6 475 40 Y 1 A PHE -1 ? A PHE 7 476 40 Y 1 A ALA 0 ? A ALA 8 477 40 Y 1 A TRP 61 ? A TRP 69 478 40 Y 1 A ILE 62 ? A ILE 70 479 40 Y 1 A SER 63 ? A SER 71 480 40 Y 1 A SER 64 ? A SER 72 481 41 Y 1 A LEU -7 ? A LEU 1 482 41 Y 1 A ALA -6 ? A ALA 2 483 41 Y 1 A ALA -5 ? A ALA 3 484 41 Y 1 A HIS -4 ? A HIS 4 485 41 Y 1 A PRO -3 ? A PRO 5 486 41 Y 1 A PRO -2 ? A PRO 6 487 41 Y 1 A PHE -1 ? A PHE 7 488 41 Y 1 A ALA 0 ? A ALA 8 489 41 Y 1 A TRP 61 ? A TRP 69 490 41 Y 1 A ILE 62 ? A ILE 70 491 41 Y 1 A SER 63 ? A SER 71 492 41 Y 1 A SER 64 ? A SER 72 493 42 Y 1 A LEU -7 ? A LEU 1 494 42 Y 1 A ALA -6 ? A ALA 2 495 42 Y 1 A ALA -5 ? A ALA 3 496 42 Y 1 A HIS -4 ? A HIS 4 497 42 Y 1 A PRO -3 ? A PRO 5 498 42 Y 1 A PRO -2 ? A PRO 6 499 42 Y 1 A PHE -1 ? A PHE 7 500 42 Y 1 A ALA 0 ? A ALA 8 501 42 Y 1 A TRP 61 ? A TRP 69 502 42 Y 1 A ILE 62 ? A ILE 70 503 42 Y 1 A SER 63 ? A SER 71 504 42 Y 1 A SER 64 ? A SER 72 505 43 Y 1 A LEU -7 ? A LEU 1 506 43 Y 1 A ALA -6 ? A ALA 2 507 43 Y 1 A ALA -5 ? A ALA 3 508 43 Y 1 A HIS -4 ? A HIS 4 509 43 Y 1 A PRO -3 ? A PRO 5 510 43 Y 1 A PRO -2 ? A PRO 6 511 43 Y 1 A PHE -1 ? A PHE 7 512 43 Y 1 A ALA 0 ? A ALA 8 513 43 Y 1 A TRP 61 ? A TRP 69 514 43 Y 1 A ILE 62 ? A ILE 70 515 43 Y 1 A SER 63 ? A SER 71 516 43 Y 1 A SER 64 ? A SER 72 517 44 Y 1 A LEU -7 ? A LEU 1 518 44 Y 1 A ALA -6 ? A ALA 2 519 44 Y 1 A ALA -5 ? A ALA 3 520 44 Y 1 A HIS -4 ? A HIS 4 521 44 Y 1 A PRO -3 ? A PRO 5 522 44 Y 1 A PRO -2 ? A PRO 6 523 44 Y 1 A PHE -1 ? A PHE 7 524 44 Y 1 A ALA 0 ? A ALA 8 525 44 Y 1 A TRP 61 ? A TRP 69 526 44 Y 1 A ILE 62 ? A ILE 70 527 44 Y 1 A SER 63 ? A SER 71 528 44 Y 1 A SER 64 ? A SER 72 529 45 Y 1 A LEU -7 ? A LEU 1 530 45 Y 1 A ALA -6 ? A ALA 2 531 45 Y 1 A ALA -5 ? A ALA 3 532 45 Y 1 A HIS -4 ? A HIS 4 533 45 Y 1 A PRO -3 ? A PRO 5 534 45 Y 1 A PRO -2 ? A PRO 6 535 45 Y 1 A PHE -1 ? A PHE 7 536 45 Y 1 A ALA 0 ? A ALA 8 537 45 Y 1 A TRP 61 ? A TRP 69 538 45 Y 1 A ILE 62 ? A ILE 70 539 45 Y 1 A SER 63 ? A SER 71 540 45 Y 1 A SER 64 ? A SER 72 541 46 Y 1 A LEU -7 ? A LEU 1 542 46 Y 1 A ALA -6 ? A ALA 2 543 46 Y 1 A ALA -5 ? A ALA 3 544 46 Y 1 A HIS -4 ? A HIS 4 545 46 Y 1 A PRO -3 ? A PRO 5 546 46 Y 1 A PRO -2 ? A PRO 6 547 46 Y 1 A PHE -1 ? A PHE 7 548 46 Y 1 A ALA 0 ? A ALA 8 549 46 Y 1 A TRP 61 ? A TRP 69 550 46 Y 1 A ILE 62 ? A ILE 70 551 46 Y 1 A SER 63 ? A SER 71 552 46 Y 1 A SER 64 ? A SER 72 553 47 Y 1 A LEU -7 ? A LEU 1 554 47 Y 1 A ALA -6 ? A ALA 2 555 47 Y 1 A ALA -5 ? A ALA 3 556 47 Y 1 A HIS -4 ? A HIS 4 557 47 Y 1 A PRO -3 ? A PRO 5 558 47 Y 1 A PRO -2 ? A PRO 6 559 47 Y 1 A PHE -1 ? A PHE 7 560 47 Y 1 A ALA 0 ? A ALA 8 561 47 Y 1 A TRP 61 ? A TRP 69 562 47 Y 1 A ILE 62 ? A ILE 70 563 47 Y 1 A SER 63 ? A SER 71 564 47 Y 1 A SER 64 ? A SER 72 565 48 Y 1 A LEU -7 ? A LEU 1 566 48 Y 1 A ALA -6 ? A ALA 2 567 48 Y 1 A ALA -5 ? A ALA 3 568 48 Y 1 A HIS -4 ? A HIS 4 569 48 Y 1 A PRO -3 ? A PRO 5 570 48 Y 1 A PRO -2 ? A PRO 6 571 48 Y 1 A PHE -1 ? A PHE 7 572 48 Y 1 A ALA 0 ? A ALA 8 573 48 Y 1 A TRP 61 ? A TRP 69 574 48 Y 1 A ILE 62 ? A ILE 70 575 48 Y 1 A SER 63 ? A SER 71 576 48 Y 1 A SER 64 ? A SER 72 577 49 Y 1 A LEU -7 ? A LEU 1 578 49 Y 1 A ALA -6 ? A ALA 2 579 49 Y 1 A ALA -5 ? A ALA 3 580 49 Y 1 A HIS -4 ? A HIS 4 581 49 Y 1 A PRO -3 ? A PRO 5 582 49 Y 1 A PRO -2 ? A PRO 6 583 49 Y 1 A PHE -1 ? A PHE 7 584 49 Y 1 A ALA 0 ? A ALA 8 585 49 Y 1 A TRP 61 ? A TRP 69 586 49 Y 1 A ILE 62 ? A ILE 70 587 49 Y 1 A SER 63 ? A SER 71 588 49 Y 1 A SER 64 ? A SER 72 589 50 Y 1 A LEU -7 ? A LEU 1 590 50 Y 1 A ALA -6 ? A ALA 2 591 50 Y 1 A ALA -5 ? A ALA 3 592 50 Y 1 A HIS -4 ? A HIS 4 593 50 Y 1 A PRO -3 ? A PRO 5 594 50 Y 1 A PRO -2 ? A PRO 6 595 50 Y 1 A PHE -1 ? A PHE 7 596 50 Y 1 A ALA 0 ? A ALA 8 597 50 Y 1 A TRP 61 ? A TRP 69 598 50 Y 1 A ILE 62 ? A ILE 70 599 50 Y 1 A SER 63 ? A SER 71 600 50 Y 1 A SER 64 ? A SER 72 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1J7M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_