data_1J7R # _entry.id 1J7R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1J7R pdb_00001j7r 10.2210/pdb1j7r/pdb RCSB RCSB013465 ? ? WWPDB D_1000013465 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1J7R _pdbx_database_status.recvd_initial_deposition_date 2001-05-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Theret, I.' 1 'Baladi, S.' 2 'Cox, J.A.' 3 'Gallay, J.' 4 'Sakamoto, H.' 5 'Craescu, C.T.' 6 # _citation.id primary _citation.title 'Solution structure and backbone dynamics of the defunct domain of calcium vector protein.' _citation.journal_abbrev Biochemistry _citation.journal_volume 40 _citation.page_first 13888 _citation.page_last 13897 _citation.year 2001 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11705378 _citation.pdbx_database_id_DOI 10.1021/bi011444q # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Theret, I.' 1 ? primary 'Baladi, S.' 2 ? primary 'Cox, J.A.' 3 ? primary 'Gallay, J.' 4 ? primary 'Sakamoto, H.' 5 ? primary 'Craescu, C.T.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Calcium Vector Protein' _entity.formula_weight 9788.155 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain (residues 1-86)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name CAVP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSK WVRQDD ; _entity_poly.pdbx_seq_one_letter_code_can ;AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSK WVRQDD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ALA n 1 3 PRO n 1 4 LYS n 1 5 ALA n 1 6 ARG n 1 7 ALA n 1 8 LEU n 1 9 GLY n 1 10 PRO n 1 11 GLU n 1 12 GLU n 1 13 LYS n 1 14 ASP n 1 15 GLU n 1 16 CYS n 1 17 MET n 1 18 LYS n 1 19 ILE n 1 20 PHE n 1 21 ASP n 1 22 ILE n 1 23 PHE n 1 24 ASP n 1 25 ARG n 1 26 ASN n 1 27 ALA n 1 28 GLU n 1 29 ASN n 1 30 ILE n 1 31 ALA n 1 32 PRO n 1 33 VAL n 1 34 SER n 1 35 ASP n 1 36 THR n 1 37 MET n 1 38 ASP n 1 39 MET n 1 40 LEU n 1 41 THR n 1 42 LYS n 1 43 LEU n 1 44 GLY n 1 45 GLN n 1 46 THR n 1 47 TYR n 1 48 THR n 1 49 LYS n 1 50 ARG n 1 51 GLU n 1 52 THR n 1 53 GLU n 1 54 ALA n 1 55 ILE n 1 56 MET n 1 57 LYS n 1 58 GLU n 1 59 ALA n 1 60 ARG n 1 61 GLY n 1 62 PRO n 1 63 LYS n 1 64 GLY n 1 65 ASP n 1 66 LYS n 1 67 LYS n 1 68 ASN n 1 69 ILE n 1 70 GLY n 1 71 PRO n 1 72 GLU n 1 73 GLU n 1 74 TRP n 1 75 LEU n 1 76 THR n 1 77 LEU n 1 78 CYS n 1 79 SER n 1 80 LYS n 1 81 TRP n 1 82 VAL n 1 83 ARG n 1 84 GLN n 1 85 ASP n 1 86 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name amphioxus _entity_src_gen.gene_src_genus Branchiostoma _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Branchiostoma lanceolatum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7740 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAVP_BRALA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSK WVRQDD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P04573 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1J7R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04573 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM KCL' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.5 mM N-CaVP unlabeled, 20 mM Deuterated Tris buffer, 100 mM KCl' '8% D20' 2 '1.5 mM N-CaVP uniformly 15N labeled, 20 mM Deuterated Tris buffer, 100 mM KCl' '8% D20' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1J7R _pdbx_nmr_refine.method ;distance geometry simulated annealing ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1J7R _pdbx_nmr_details.text 'Residues listed in remark 465 are missing due to lack of NMR contsraints.' # _pdbx_nmr_ensemble.entry_id 1J7R _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal Felix 97.0 processing MSI 1 Felix 97.0 'data analysis' MSI 2 Felix 97.0 collection MSI 3 DGII 97.0 'structure solution' MSI 4 Discover ? refinement MSI 5 # _exptl.entry_id 1J7R _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1J7R _struct.title 'Solution structure and backbone dynamics of the defunct EF-hand domain of Calcium Vector Protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1J7R _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'EF-HAND, Calcium Binding Protein, METAL BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 8 ? PRO A 10 ? LEU A 8 PRO A 10 5 ? 3 HELX_P HELX_P2 2 GLU A 11 ? PHE A 23 ? GLU A 11 PHE A 23 1 ? 13 HELX_P HELX_P3 3 PRO A 32 ? LEU A 43 ? PRO A 32 LEU A 43 1 ? 12 HELX_P HELX_P4 4 ARG A 50 ? ALA A 59 ? ARG A 50 ALA A 59 1 ? 10 HELX_P HELX_P5 5 GLU A 72 ? ARG A 83 ? GLU A 72 ARG A 83 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1J7R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1J7R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _database_PDB_caveat.text 'CHIRALITY ERROR AT CB CENTER OF THR 76.' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 ARG 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ASP 85 85 ? ? ? A . n A 1 86 ASP 86 86 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-06-06 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 12 ? ? HH A TYR 47 ? ? 1.56 2 1 O A MET 39 ? ? H A LEU 43 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TRP 74 ? ? CG A TRP 74 ? ? CD2 A TRP 74 ? ? 117.04 126.60 -9.56 1.30 N 2 1 CB A TRP 74 ? ? CG A TRP 74 ? ? CD1 A TRP 74 ? ? 117.49 127.00 -9.51 1.30 N 3 1 NE1 A TRP 74 ? ? CE2 A TRP 74 ? ? CZ2 A TRP 74 ? ? 121.48 130.40 -8.92 1.10 N 4 1 CG A TRP 74 ? ? CD2 A TRP 74 ? ? CE3 A TRP 74 ? ? 121.03 133.90 -12.87 0.90 N 5 1 NE1 A TRP 81 ? ? CE2 A TRP 81 ? ? CZ2 A TRP 81 ? ? 121.30 130.40 -9.10 1.10 N 6 1 CG A TRP 81 ? ? CD2 A TRP 81 ? ? CE3 A TRP 81 ? ? 122.20 133.90 -11.70 0.90 N 7 1 N A GLN 84 ? ? CA A GLN 84 ? ? C A GLN 84 ? ? 53.48 111.00 -57.52 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 25 ? ? 87.69 -57.80 2 1 ASN A 26 ? ? 167.70 -51.72 3 1 ALA A 27 ? ? -153.03 79.81 4 1 GLU A 28 ? ? -133.72 -44.44 5 1 MET A 39 ? ? -66.99 -74.08 6 1 LEU A 40 ? ? -68.84 0.06 7 1 GLN A 45 ? ? -178.03 -57.46 8 1 TYR A 47 ? ? -111.40 -103.30 9 1 THR A 48 ? ? -83.31 -96.27 10 1 LYS A 49 ? ? -165.05 -68.04 11 1 ARG A 60 ? ? -50.11 -87.29 12 1 LYS A 66 ? ? -144.34 55.54 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 20 ? ? 0.258 'SIDE CHAIN' 2 1 ARG A 25 ? ? 0.202 'SIDE CHAIN' 3 1 TYR A 47 ? ? 0.097 'SIDE CHAIN' 4 1 ARG A 50 ? ? 0.122 'SIDE CHAIN' 5 1 ARG A 60 ? ? 0.206 'SIDE CHAIN' 6 1 ARG A 83 ? ? 0.152 'SIDE CHAIN' # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CB _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id THR _pdbx_validate_chiral.auth_seq_id 76 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ARG 6 ? A ARG 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A ASP 85 ? A ASP 85 9 1 Y 1 A ASP 86 ? A ASP 86 #