data_1JBI
# 
_entry.id   1JBI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1JBI         pdb_00001jbi 10.2210/pdb1jbi/pdb 
RCSB  RCSB013587   ?            ?                   
WWPDB D_1000013587 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-17 
2 'Structure model' 1 1 2007-10-21 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-02-23 
5 'Structure model' 1 4 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2                
2 4 'Structure model' pdbx_nmr_software         
3 4 'Structure model' pdbx_struct_assembly      
4 4 'Structure model' pdbx_struct_oper_list     
5 4 'Structure model' struct_ref_seq_dif        
6 5 'Structure model' chem_comp_atom            
7 5 'Structure model' chem_comp_bond            
8 5 'Structure model' pdbx_entry_details        
9 5 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JBI 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liepinsh, E.'  1 
'Trexler, M.'   2 
'Kaikkonen, A.' 3 
'Weigelt, J.'   4 
'Banyai, L.'    5 
'Patthy, L.'    6 
'Otting, G.'    7 
# 
_citation.id                        primary 
_citation.title                     'NMR structure of the LCCL domain and implications for DFNA9 deafness disorder.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            20 
_citation.page_first                5347 
_citation.page_last                 5353 
_citation.year                      2001 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11574466 
_citation.pdbx_database_id_DOI      10.1093/emboj/20.19.5347 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liepinsh, E.'  1 ? 
primary 'Trexler, M.'   2 ? 
primary 'Kaikkonen, A.' 3 ? 
primary 'Weigelt, J.'   4 ? 
primary 'Banyai, L.'    5 ? 
primary 'Patthy, L.'    6 ? 
primary 'Otting, G.'    7 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           cochlin 
_entity.formula_weight             10609.979 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'LCCL module' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        COCH-5B2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDA
NGIQSQMLSRWSASFTVTLE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDA
NGIQSQMLSRWSASFTVTLE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   ALA n 
1 3   PRO n 
1 4   ILE n 
1 5   ALA n 
1 6   ILE n 
1 7   THR n 
1 8   CYS n 
1 9   PHE n 
1 10  THR n 
1 11  ARG n 
1 12  GLY n 
1 13  LEU n 
1 14  ASP n 
1 15  ILE n 
1 16  ARG n 
1 17  LYS n 
1 18  GLU n 
1 19  LYS n 
1 20  ALA n 
1 21  ASP n 
1 22  VAL n 
1 23  LEU n 
1 24  CYS n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  CYS n 
1 29  PRO n 
1 30  LEU n 
1 31  GLU n 
1 32  GLU n 
1 33  PHE n 
1 34  SER n 
1 35  VAL n 
1 36  TYR n 
1 37  GLY n 
1 38  ASN n 
1 39  ILE n 
1 40  VAL n 
1 41  TYR n 
1 42  ALA n 
1 43  SER n 
1 44  VAL n 
1 45  SER n 
1 46  SER n 
1 47  ILE n 
1 48  CYS n 
1 49  GLY n 
1 50  ALA n 
1 51  ALA n 
1 52  VAL n 
1 53  HIS n 
1 54  ARG n 
1 55  GLY n 
1 56  VAL n 
1 57  ILE n 
1 58  SER n 
1 59  ASN n 
1 60  SER n 
1 61  GLY n 
1 62  GLY n 
1 63  PRO n 
1 64  VAL n 
1 65  ARG n 
1 66  VAL n 
1 67  TYR n 
1 68  SER n 
1 69  LEU n 
1 70  PRO n 
1 71  GLY n 
1 72  ARG n 
1 73  GLU n 
1 74  ASN n 
1 75  TYR n 
1 76  SER n 
1 77  SER n 
1 78  VAL n 
1 79  ASP n 
1 80  ALA n 
1 81  ASN n 
1 82  GLY n 
1 83  ILE n 
1 84  GLN n 
1 85  SER n 
1 86  GLN n 
1 87  MET n 
1 88  LEU n 
1 89  SER n 
1 90  ARG n 
1 91  TRP n 
1 92  SER n 
1 93  ALA n 
1 94  SER n 
1 95  PHE n 
1 96  THR n 
1 97  VAL n 
1 98  THR n 
1 99  LEU n 
1 100 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 M13mp18 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'JM 109' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pmed23 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   1   1   THR THR A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  CYS 24  24  24  CYS CYS A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  CYS 28  28  28  CYS CYS A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  CYS 48  48  48  CYS CYS A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  TRP 91  91  91  TRP TRP A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  PHE 95  95  95  PHE PHE A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
# 
_cell.entry_id           1JBI 
_cell.length_a           ? 
_cell.length_b           ? 
_cell.length_c           ? 
_cell.angle_alpha        ? 
_cell.angle_beta         ? 
_cell.angle_gamma        ? 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_exptl.entry_id          1JBI 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1JBI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1JBI 
_struct.title                     'NMR structure of the LCCL domain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JBI 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            'alpha-beta protein, STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COCH_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDA
NGIQSQMLSRWSASFTVTKG
;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_accession          O43405 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1JBI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 100 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O43405 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  126 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       100 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1JBI THR A 1   ? UNP O43405 ALA 27  conflict 1   1 
1 1JBI LEU A 99  ? UNP O43405 LYS 125 conflict 99  2 
1 1JBI GLU A 100 ? UNP O43405 GLY 126 conflict 100 3 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        46 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        55 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         46 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         55 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 8  SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 8  A CYS 24 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf2 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 28 A CYS 48 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 8  ? CYS A 24 ? CYS A 8  ? 1_555 CYS A 24 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 28 ? CYS A 48 ? CYS A 28 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 4  ? ALA A 5  ? ILE A 4  ALA A 5  
A 2 LYS A 19 ? CYS A 24 ? LYS A 19 CYS A 24 
A 3 GLY A 62 ? LEU A 69 ? GLY A 62 LEU A 69 
A 4 SER A 94 ? THR A 98 ? SER A 94 THR A 98 
A 5 TYR A 41 ? ALA A 42 ? TYR A 41 ALA A 42 
B 1 VAL A 35 ? TYR A 36 ? VAL A 35 TYR A 36 
B 2 GLN A 84 ? GLN A 86 ? GLN A 84 GLN A 86 
B 3 VAL A 78 ? ASP A 79 ? VAL A 78 ASP A 79 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 4  ? N ILE A 4  O ASP A 21 ? O ASP A 21 
A 2 3 O CYS A 24 ? O CYS A 24 N GLY A 62 ? N GLY A 62 
A 3 4 N LEU A 69 ? N LEU A 69 O SER A 94 ? O SER A 94 
A 4 5 O PHE A 95 ? O PHE A 95 N TYR A 41 ? N TYR A 41 
B 1 2 N VAL A 35 ? N VAL A 35 O GLN A 84 ? O GLN A 84 
B 2 3 N SER A 85 ? N SER A 85 O VAL A 78 ? O VAL A 78 
# 
_pdbx_entry_details.entry_id                   1JBI 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1  NE A ARG 90 ? ? CZ A ARG 90 ? ? NH2 A ARG 90 ? ? 117.27 120.30 -3.03 0.50 N 
2 5  NE A ARG 65 ? ? CZ A ARG 65 ? ? NH2 A ARG 65 ? ? 116.78 120.30 -3.52 0.50 N 
3 8  NE A ARG 54 ? ? CZ A ARG 54 ? ? NH2 A ARG 54 ? ? 117.14 120.30 -3.16 0.50 N 
4 9  NE A ARG 72 ? ? CZ A ARG 72 ? ? NH2 A ARG 72 ? ? 117.28 120.30 -3.02 0.50 N 
5 14 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH2 A ARG 65 ? ? 116.90 120.30 -3.40 0.50 N 
6 19 CB A TYR 67 ? ? CG A TYR 67 ? ? CD1 A TYR 67 ? ? 116.96 121.00 -4.04 0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  CYS A 8  ? ? 54.33   13.37   
2   1  CYS A 28 ? ? 41.15   75.51   
3   1  LEU A 30 ? ? -69.52  63.95   
4   1  ILE A 39 ? ? 63.36   -67.02  
5   1  SER A 60 ? ? -145.86 -13.00  
6   1  ARG A 90 ? ? 61.28   62.08   
7   1  SER A 92 ? ? -78.82  35.50   
8   2  CYS A 8  ? ? 51.24   13.70   
9   2  CYS A 28 ? ? 41.05   70.33   
10  2  ILE A 39 ? ? 62.03   -64.12  
11  2  SER A 60 ? ? -146.84 -14.32  
12  2  ARG A 90 ? ? 65.07   62.28   
13  2  SER A 92 ? ? -78.78  33.96   
14  2  ALA A 93 ? ? -165.91 115.35  
15  3  ALA A 2  ? ? -179.99 98.89   
16  3  THR A 7  ? ? -102.21 46.27   
17  3  CYS A 8  ? ? 51.21   13.00   
18  3  CYS A 28 ? ? 32.35   70.49   
19  3  ILE A 39 ? ? 63.64   -60.84  
20  3  SER A 60 ? ? -147.09 -13.46  
21  3  ARG A 90 ? ? 60.09   61.86   
22  3  SER A 92 ? ? -78.91  33.79   
23  3  ALA A 93 ? ? -161.92 112.50  
24  4  CYS A 8  ? ? 56.51   13.45   
25  4  ALA A 20 ? ? -175.86 147.39  
26  4  CYS A 28 ? ? 28.19   70.76   
27  4  ILE A 39 ? ? 61.39   -65.59  
28  4  SER A 60 ? ? -146.86 -66.07  
29  4  PRO A 70 ? ? -68.18  -179.35 
30  4  SER A 92 ? ? -80.50  33.81   
31  5  CYS A 8  ? ? 51.82   13.23   
32  5  CYS A 28 ? ? 40.79   71.89   
33  5  ILE A 39 ? ? 62.44   -66.97  
34  5  ASN A 59 ? ? -65.90  73.47   
35  5  SER A 60 ? ? -147.20 -13.80  
36  5  PRO A 70 ? ? -59.70  171.11  
37  5  SER A 89 ? ? -100.47 79.32   
38  5  SER A 92 ? ? -78.91  33.79   
39  5  ALA A 93 ? ? -161.96 108.68  
40  6  CYS A 8  ? ? 49.82   13.68   
41  6  ARG A 16 ? ? -119.89 64.42   
42  6  CYS A 28 ? ? 42.08   76.63   
43  6  ILE A 39 ? ? 63.90   -61.29  
44  6  ASN A 59 ? ? -64.03  74.35   
45  6  SER A 60 ? ? -146.72 -21.27  
46  6  SER A 92 ? ? -78.73  33.39   
47  6  ALA A 93 ? ? -160.27 95.44   
48  7  PRO A 3  ? ? -64.99  -179.79 
49  7  CYS A 8  ? ? 57.85   13.32   
50  7  CYS A 28 ? ? 40.87   76.09   
51  7  GLU A 31 ? ? -96.37  -69.49  
52  7  ILE A 39 ? ? 59.44   -69.05  
53  7  SER A 60 ? ? -146.36 -13.59  
54  7  ARG A 90 ? ? 61.85   62.11   
55  7  SER A 92 ? ? -78.67  33.78   
56  8  THR A 7  ? ? -84.21  34.15   
57  8  CYS A 8  ? ? 46.28   12.69   
58  8  CYS A 28 ? ? 41.45   76.56   
59  8  ILE A 39 ? ? 63.62   -64.42  
60  8  ASN A 59 ? ? -63.90  72.79   
61  8  SER A 60 ? ? -147.51 -13.91  
62  8  ARG A 90 ? ? 61.91   61.91   
63  8  SER A 92 ? ? -79.22  33.74   
64  9  PRO A 3  ? ? -69.85  -178.38 
65  9  CYS A 8  ? ? 49.22   12.82   
66  9  CYS A 28 ? ? 40.74   76.16   
67  9  PRO A 29 ? ? -69.71  -173.94 
68  9  ILE A 39 ? ? 64.65   -63.08  
69  9  SER A 60 ? ? -147.31 -13.51  
70  9  PRO A 70 ? ? -58.19  171.12  
71  9  ARG A 90 ? ? 64.02   62.38   
72  9  SER A 92 ? ? -80.24  33.35   
73  9  ALA A 93 ? ? -166.53 110.13  
74  10 CYS A 28 ? ? 41.67   76.36   
75  10 GLU A 31 ? ? -97.54  -63.70  
76  10 ILE A 39 ? ? 58.64   -75.66  
77  10 ASN A 59 ? ? -68.33  73.09   
78  10 SER A 60 ? ? -146.99 -13.40  
79  10 SER A 92 ? ? -78.78  33.69   
80  11 ALA A 2  ? ? 178.18  156.32  
81  11 CYS A 28 ? ? 41.67   76.25   
82  11 GLU A 31 ? ? -96.55  -60.81  
83  11 ILE A 39 ? ? 62.52   -67.35  
84  11 SER A 60 ? ? -146.69 -13.27  
85  11 ASN A 81 ? ? 48.51   24.17   
86  11 ARG A 90 ? ? 61.13   61.90   
87  11 SER A 92 ? ? -78.53  34.12   
88  12 CYS A 8  ? ? 47.96   13.27   
89  12 CYS A 28 ? ? 40.02   76.45   
90  12 ILE A 39 ? ? 62.70   -61.23  
91  12 SER A 60 ? ? -146.66 -65.51  
92  12 PRO A 70 ? ? -64.99  -177.24 
93  12 SER A 92 ? ? -90.17  33.01   
94  12 ALA A 93 ? ? -165.90 102.87  
95  13 CYS A 8  ? ? 41.02   12.91   
96  13 CYS A 28 ? ? 41.12   75.96   
97  13 LEU A 30 ? ? -69.90  64.90   
98  13 GLU A 31 ? ? -96.24  -75.64  
99  13 ILE A 39 ? ? 63.51   -59.94  
100 13 SER A 60 ? ? -146.76 -13.45  
101 13 PRO A 70 ? ? -63.87  -178.37 
102 13 ARG A 90 ? ? 62.15   62.24   
103 13 SER A 92 ? ? -79.20  33.20   
104 13 ALA A 93 ? ? -166.52 116.20  
105 14 CYS A 8  ? ? 54.18   16.24   
106 14 CYS A 28 ? ? 29.01   75.72   
107 14 GLU A 32 ? ? -150.11 88.65   
108 14 ILE A 39 ? ? 62.11   -63.09  
109 14 SER A 60 ? ? -147.05 -13.59  
110 14 SER A 92 ? ? -78.42  33.31   
111 15 ALA A 2  ? ? 173.97  136.53  
112 15 CYS A 8  ? ? 58.06   16.26   
113 15 CYS A 28 ? ? 41.57   76.03   
114 15 ILE A 39 ? ? 62.44   -61.78  
115 15 SER A 60 ? ? -147.07 -14.32  
116 15 SER A 89 ? ? -111.09 77.51   
117 15 ARG A 90 ? ? 66.49   61.86   
118 15 SER A 92 ? ? -78.91  34.11   
119 15 ALA A 93 ? ? -164.02 110.74  
120 16 PRO A 3  ? ? -67.43  -173.61 
121 16 CYS A 28 ? ? 41.22   76.03   
122 16 GLU A 31 ? ? -96.73  -70.51  
123 16 ILE A 39 ? ? 62.51   -55.32  
124 16 ASN A 59 ? ? -63.69  73.25   
125 16 SER A 60 ? ? -146.82 -29.24  
126 16 ARG A 90 ? ? 62.86   62.26   
127 16 SER A 92 ? ? -80.08  33.94   
128 16 ALA A 93 ? ? -164.24 114.83  
129 17 CYS A 8  ? ? 56.69   19.39   
130 17 THR A 10 ? ? -29.59  118.54  
131 17 CYS A 24 ? ? -111.11 79.83   
132 17 CYS A 28 ? ? 41.33   76.37   
133 17 GLU A 31 ? ? -87.35  -75.83  
134 17 ILE A 39 ? ? 59.91   -62.40  
135 17 SER A 60 ? ? -147.23 -13.62  
136 17 ARG A 90 ? ? 66.36   61.85   
137 17 SER A 92 ? ? -78.70  33.67   
138 17 ALA A 93 ? ? -164.28 106.12  
139 18 CYS A 8  ? ? 55.98   13.26   
140 18 ARG A 16 ? ? -108.94 65.99   
141 18 CYS A 28 ? ? 30.76   68.82   
142 18 ILE A 39 ? ? 61.88   -65.11  
143 18 SER A 60 ? ? -146.92 -16.53  
144 18 SER A 92 ? ? -78.63  33.60   
145 19 CYS A 8  ? ? 48.25   12.95   
146 19 CYS A 28 ? ? 37.60   76.03   
147 19 ILE A 39 ? ? 62.46   -62.05  
148 19 SER A 60 ? ? -146.79 -13.60  
149 19 PRO A 70 ? ? -58.37  174.29  
150 19 SER A 92 ? ? -81.59  33.45   
151 19 ALA A 93 ? ? -165.70 101.25  
152 20 ARG A 16 ? ? -99.37  35.52   
153 20 CYS A 28 ? ? 41.15   75.13   
154 20 GLU A 31 ? ? -96.53  -66.30  
155 20 ILE A 39 ? ? 64.56   -59.08  
156 20 SER A 60 ? ? -147.14 -13.86  
157 20 SER A 89 ? ? -106.13 76.81   
158 20 SER A 92 ? ? -80.23  33.94   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 4  THR A 1 ? ? ALA A 2 ? ? -65.98  
2 19 THR A 1 ? ? ALA A 2 ? ? -139.20 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  TYR A 41 ? ? 0.075 'SIDE CHAIN' 
2  1  ARG A 65 ? ? 0.131 'SIDE CHAIN' 
3  1  TYR A 67 ? ? 0.079 'SIDE CHAIN' 
4  2  ARG A 72 ? ? 0.102 'SIDE CHAIN' 
5  3  TYR A 36 ? ? 0.077 'SIDE CHAIN' 
6  3  ARG A 72 ? ? 0.118 'SIDE CHAIN' 
7  5  ARG A 72 ? ? 0.089 'SIDE CHAIN' 
8  6  TYR A 41 ? ? 0.082 'SIDE CHAIN' 
9  6  TYR A 67 ? ? 0.071 'SIDE CHAIN' 
10 6  ARG A 90 ? ? 0.090 'SIDE CHAIN' 
11 8  ARG A 54 ? ? 0.092 'SIDE CHAIN' 
12 9  ARG A 16 ? ? 0.086 'SIDE CHAIN' 
13 9  TYR A 41 ? ? 0.072 'SIDE CHAIN' 
14 10 TYR A 41 ? ? 0.077 'SIDE CHAIN' 
15 10 TYR A 67 ? ? 0.066 'SIDE CHAIN' 
16 11 ARG A 16 ? ? 0.104 'SIDE CHAIN' 
17 11 TYR A 41 ? ? 0.070 'SIDE CHAIN' 
18 12 TYR A 75 ? ? 0.084 'SIDE CHAIN' 
19 12 ARG A 90 ? ? 0.076 'SIDE CHAIN' 
20 13 ARG A 90 ? ? 0.155 'SIDE CHAIN' 
21 14 ARG A 54 ? ? 0.155 'SIDE CHAIN' 
22 14 ARG A 72 ? ? 0.080 'SIDE CHAIN' 
23 15 ARG A 16 ? ? 0.117 'SIDE CHAIN' 
24 15 ARG A 72 ? ? 0.107 'SIDE CHAIN' 
25 16 ARG A 16 ? ? 0.081 'SIDE CHAIN' 
26 16 TYR A 41 ? ? 0.099 'SIDE CHAIN' 
27 18 ARG A 72 ? ? 0.099 'SIDE CHAIN' 
28 19 TYR A 36 ? ? 0.073 'SIDE CHAIN' 
29 20 TYR A 41 ? ? 0.107 'SIDE CHAIN' 
30 20 ARG A 90 ? ? 0.151 'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.entry_id                                      1JBI 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy,target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1JBI 
_pdbx_nmr_representative.conformer_id         15 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1mM LCCL; 90% H2O, 10% D2O'          '90% H2O/10% D2O' 
2 '3mg/ml LCCL U-15N; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 301 ambient 4.9 0.1 ? K 
2 301 ambient 4.9 0.1 ? K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D NOESY,2D ROESY, 2D DQF-COSY,2D TOCSY'                    
2 2 2 '3D-15N-separated-NOESY,3D-15N-separated-TOCSY, 1H-15N-HSQC' 
# 
_pdbx_nmr_details.entry_id   1JBI 
_pdbx_nmr_details.text       'This structure was determined using standard 2D homonuclear techniques' 
# 
_pdbx_nmr_refine.entry_id           1JBI 
_pdbx_nmr_refine.method             'torsion angle dynamics,simulated annealing' 
_pdbx_nmr_refine.details            
;the structures are based on a total of 2532 restraints, 1193 are NOE-derived 
distance constraints, 270 dihedral angle restraints and 69 residual dipolar coupling restraints
;
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.5 collection           Bruker    1 
PROSA   3.4 processing           Guntert   2 
XEASY   2.6 'data analysis'      Guntert   3 
DYANA   1.5 'structure solution' Guntert   4 
OPAL    2.2 refinement           Luginbuhl 5 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TRP N    N N N 318 
TRP CA   C N S 319 
TRP C    C N N 320 
TRP O    O N N 321 
TRP CB   C N N 322 
TRP CG   C Y N 323 
TRP CD1  C Y N 324 
TRP CD2  C Y N 325 
TRP NE1  N Y N 326 
TRP CE2  C Y N 327 
TRP CE3  C Y N 328 
TRP CZ2  C Y N 329 
TRP CZ3  C Y N 330 
TRP CH2  C Y N 331 
TRP OXT  O N N 332 
TRP H    H N N 333 
TRP H2   H N N 334 
TRP HA   H N N 335 
TRP HB2  H N N 336 
TRP HB3  H N N 337 
TRP HD1  H N N 338 
TRP HE1  H N N 339 
TRP HE3  H N N 340 
TRP HZ2  H N N 341 
TRP HZ3  H N N 342 
TRP HH2  H N N 343 
TRP HXT  H N N 344 
TYR N    N N N 345 
TYR CA   C N S 346 
TYR C    C N N 347 
TYR O    O N N 348 
TYR CB   C N N 349 
TYR CG   C Y N 350 
TYR CD1  C Y N 351 
TYR CD2  C Y N 352 
TYR CE1  C Y N 353 
TYR CE2  C Y N 354 
TYR CZ   C Y N 355 
TYR OH   O N N 356 
TYR OXT  O N N 357 
TYR H    H N N 358 
TYR H2   H N N 359 
TYR HA   H N N 360 
TYR HB2  H N N 361 
TYR HB3  H N N 362 
TYR HD1  H N N 363 
TYR HD2  H N N 364 
TYR HE1  H N N 365 
TYR HE2  H N N 366 
TYR HH   H N N 367 
TYR HXT  H N N 368 
VAL N    N N N 369 
VAL CA   C N S 370 
VAL C    C N N 371 
VAL O    O N N 372 
VAL CB   C N N 373 
VAL CG1  C N N 374 
VAL CG2  C N N 375 
VAL OXT  O N N 376 
VAL H    H N N 377 
VAL H2   H N N 378 
VAL HA   H N N 379 
VAL HB   H N N 380 
VAL HG11 H N N 381 
VAL HG12 H N N 382 
VAL HG13 H N N 383 
VAL HG21 H N N 384 
VAL HG22 H N N 385 
VAL HG23 H N N 386 
VAL HXT  H N N 387 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DMX   600 
2 ? Varian UNITY 800 
# 
_atom_sites.entry_id                    1JBI 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_