data_1JBI # _entry.id 1JBI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JBI pdb_00001jbi 10.2210/pdb1jbi/pdb RCSB RCSB013587 ? ? WWPDB D_1000013587 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-10-17 2 'Structure model' 1 1 2007-10-21 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JBI _pdbx_database_status.recvd_initial_deposition_date 2001-06-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liepinsh, E.' 1 'Trexler, M.' 2 'Kaikkonen, A.' 3 'Weigelt, J.' 4 'Banyai, L.' 5 'Patthy, L.' 6 'Otting, G.' 7 # _citation.id primary _citation.title 'NMR structure of the LCCL domain and implications for DFNA9 deafness disorder.' _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 20 _citation.page_first 5347 _citation.page_last 5353 _citation.year 2001 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11574466 _citation.pdbx_database_id_DOI 10.1093/emboj/20.19.5347 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liepinsh, E.' 1 ? primary 'Trexler, M.' 2 ? primary 'Kaikkonen, A.' 3 ? primary 'Weigelt, J.' 4 ? primary 'Banyai, L.' 5 ? primary 'Patthy, L.' 6 ? primary 'Otting, G.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description cochlin _entity.formula_weight 10609.979 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'LCCL module' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name COCH-5B2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDA NGIQSQMLSRWSASFTVTLE ; _entity_poly.pdbx_seq_one_letter_code_can ;TAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDA NGIQSQMLSRWSASFTVTLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ALA n 1 3 PRO n 1 4 ILE n 1 5 ALA n 1 6 ILE n 1 7 THR n 1 8 CYS n 1 9 PHE n 1 10 THR n 1 11 ARG n 1 12 GLY n 1 13 LEU n 1 14 ASP n 1 15 ILE n 1 16 ARG n 1 17 LYS n 1 18 GLU n 1 19 LYS n 1 20 ALA n 1 21 ASP n 1 22 VAL n 1 23 LEU n 1 24 CYS n 1 25 PRO n 1 26 GLY n 1 27 GLY n 1 28 CYS n 1 29 PRO n 1 30 LEU n 1 31 GLU n 1 32 GLU n 1 33 PHE n 1 34 SER n 1 35 VAL n 1 36 TYR n 1 37 GLY n 1 38 ASN n 1 39 ILE n 1 40 VAL n 1 41 TYR n 1 42 ALA n 1 43 SER n 1 44 VAL n 1 45 SER n 1 46 SER n 1 47 ILE n 1 48 CYS n 1 49 GLY n 1 50 ALA n 1 51 ALA n 1 52 VAL n 1 53 HIS n 1 54 ARG n 1 55 GLY n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 ASN n 1 60 SER n 1 61 GLY n 1 62 GLY n 1 63 PRO n 1 64 VAL n 1 65 ARG n 1 66 VAL n 1 67 TYR n 1 68 SER n 1 69 LEU n 1 70 PRO n 1 71 GLY n 1 72 ARG n 1 73 GLU n 1 74 ASN n 1 75 TYR n 1 76 SER n 1 77 SER n 1 78 VAL n 1 79 ASP n 1 80 ALA n 1 81 ASN n 1 82 GLY n 1 83 ILE n 1 84 GLN n 1 85 SER n 1 86 GLN n 1 87 MET n 1 88 LEU n 1 89 SER n 1 90 ARG n 1 91 TRP n 1 92 SER n 1 93 ALA n 1 94 SER n 1 95 PHE n 1 96 THR n 1 97 VAL n 1 98 THR n 1 99 LEU n 1 100 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene M13mp18 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'JM 109' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pmed23 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n # _cell.entry_id 1JBI _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _exptl.entry_id 1JBI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1JBI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1JBI _struct.title 'NMR structure of the LCCL domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JBI _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'alpha-beta protein, STRUCTURAL GENOMICS, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COCH_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDA NGIQSQMLSRWSASFTVTKG ; _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_accession O43405 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JBI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43405 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1JBI THR A 1 ? UNP O43405 ALA 27 conflict 1 1 1 1JBI LEU A 99 ? UNP O43405 LYS 125 conflict 99 2 1 1JBI GLU A 100 ? UNP O43405 GLY 126 conflict 100 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 46 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 55 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 46 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 55 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 8 A CYS 24 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf2 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 28 A CYS 48 1_555 ? ? ? ? ? ? ? 2.034 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 8 ? CYS A 24 ? CYS A 8 ? 1_555 CYS A 24 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 28 ? CYS A 48 ? CYS A 28 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 4 ? ALA A 5 ? ILE A 4 ALA A 5 A 2 LYS A 19 ? CYS A 24 ? LYS A 19 CYS A 24 A 3 GLY A 62 ? LEU A 69 ? GLY A 62 LEU A 69 A 4 SER A 94 ? THR A 98 ? SER A 94 THR A 98 A 5 TYR A 41 ? ALA A 42 ? TYR A 41 ALA A 42 B 1 VAL A 35 ? TYR A 36 ? VAL A 35 TYR A 36 B 2 GLN A 84 ? GLN A 86 ? GLN A 84 GLN A 86 B 3 VAL A 78 ? ASP A 79 ? VAL A 78 ASP A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 4 ? N ILE A 4 O ASP A 21 ? O ASP A 21 A 2 3 O CYS A 24 ? O CYS A 24 N GLY A 62 ? N GLY A 62 A 3 4 N LEU A 69 ? N LEU A 69 O SER A 94 ? O SER A 94 A 4 5 O PHE A 95 ? O PHE A 95 N TYR A 41 ? N TYR A 41 B 1 2 N VAL A 35 ? N VAL A 35 O GLN A 84 ? O GLN A 84 B 2 3 N SER A 85 ? N SER A 85 O VAL A 78 ? O VAL A 78 # _pdbx_entry_details.entry_id 1JBI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 90 ? ? CZ A ARG 90 ? ? NH2 A ARG 90 ? ? 117.27 120.30 -3.03 0.50 N 2 5 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH2 A ARG 65 ? ? 116.78 120.30 -3.52 0.50 N 3 8 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH2 A ARG 54 ? ? 117.14 120.30 -3.16 0.50 N 4 9 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH2 A ARG 72 ? ? 117.28 120.30 -3.02 0.50 N 5 14 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH2 A ARG 65 ? ? 116.90 120.30 -3.40 0.50 N 6 19 CB A TYR 67 ? ? CG A TYR 67 ? ? CD1 A TYR 67 ? ? 116.96 121.00 -4.04 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 8 ? ? 54.33 13.37 2 1 CYS A 28 ? ? 41.15 75.51 3 1 LEU A 30 ? ? -69.52 63.95 4 1 ILE A 39 ? ? 63.36 -67.02 5 1 SER A 60 ? ? -145.86 -13.00 6 1 ARG A 90 ? ? 61.28 62.08 7 1 SER A 92 ? ? -78.82 35.50 8 2 CYS A 8 ? ? 51.24 13.70 9 2 CYS A 28 ? ? 41.05 70.33 10 2 ILE A 39 ? ? 62.03 -64.12 11 2 SER A 60 ? ? -146.84 -14.32 12 2 ARG A 90 ? ? 65.07 62.28 13 2 SER A 92 ? ? -78.78 33.96 14 2 ALA A 93 ? ? -165.91 115.35 15 3 ALA A 2 ? ? -179.99 98.89 16 3 THR A 7 ? ? -102.21 46.27 17 3 CYS A 8 ? ? 51.21 13.00 18 3 CYS A 28 ? ? 32.35 70.49 19 3 ILE A 39 ? ? 63.64 -60.84 20 3 SER A 60 ? ? -147.09 -13.46 21 3 ARG A 90 ? ? 60.09 61.86 22 3 SER A 92 ? ? -78.91 33.79 23 3 ALA A 93 ? ? -161.92 112.50 24 4 CYS A 8 ? ? 56.51 13.45 25 4 ALA A 20 ? ? -175.86 147.39 26 4 CYS A 28 ? ? 28.19 70.76 27 4 ILE A 39 ? ? 61.39 -65.59 28 4 SER A 60 ? ? -146.86 -66.07 29 4 PRO A 70 ? ? -68.18 -179.35 30 4 SER A 92 ? ? -80.50 33.81 31 5 CYS A 8 ? ? 51.82 13.23 32 5 CYS A 28 ? ? 40.79 71.89 33 5 ILE A 39 ? ? 62.44 -66.97 34 5 ASN A 59 ? ? -65.90 73.47 35 5 SER A 60 ? ? -147.20 -13.80 36 5 PRO A 70 ? ? -59.70 171.11 37 5 SER A 89 ? ? -100.47 79.32 38 5 SER A 92 ? ? -78.91 33.79 39 5 ALA A 93 ? ? -161.96 108.68 40 6 CYS A 8 ? ? 49.82 13.68 41 6 ARG A 16 ? ? -119.89 64.42 42 6 CYS A 28 ? ? 42.08 76.63 43 6 ILE A 39 ? ? 63.90 -61.29 44 6 ASN A 59 ? ? -64.03 74.35 45 6 SER A 60 ? ? -146.72 -21.27 46 6 SER A 92 ? ? -78.73 33.39 47 6 ALA A 93 ? ? -160.27 95.44 48 7 PRO A 3 ? ? -64.99 -179.79 49 7 CYS A 8 ? ? 57.85 13.32 50 7 CYS A 28 ? ? 40.87 76.09 51 7 GLU A 31 ? ? -96.37 -69.49 52 7 ILE A 39 ? ? 59.44 -69.05 53 7 SER A 60 ? ? -146.36 -13.59 54 7 ARG A 90 ? ? 61.85 62.11 55 7 SER A 92 ? ? -78.67 33.78 56 8 THR A 7 ? ? -84.21 34.15 57 8 CYS A 8 ? ? 46.28 12.69 58 8 CYS A 28 ? ? 41.45 76.56 59 8 ILE A 39 ? ? 63.62 -64.42 60 8 ASN A 59 ? ? -63.90 72.79 61 8 SER A 60 ? ? -147.51 -13.91 62 8 ARG A 90 ? ? 61.91 61.91 63 8 SER A 92 ? ? -79.22 33.74 64 9 PRO A 3 ? ? -69.85 -178.38 65 9 CYS A 8 ? ? 49.22 12.82 66 9 CYS A 28 ? ? 40.74 76.16 67 9 PRO A 29 ? ? -69.71 -173.94 68 9 ILE A 39 ? ? 64.65 -63.08 69 9 SER A 60 ? ? -147.31 -13.51 70 9 PRO A 70 ? ? -58.19 171.12 71 9 ARG A 90 ? ? 64.02 62.38 72 9 SER A 92 ? ? -80.24 33.35 73 9 ALA A 93 ? ? -166.53 110.13 74 10 CYS A 28 ? ? 41.67 76.36 75 10 GLU A 31 ? ? -97.54 -63.70 76 10 ILE A 39 ? ? 58.64 -75.66 77 10 ASN A 59 ? ? -68.33 73.09 78 10 SER A 60 ? ? -146.99 -13.40 79 10 SER A 92 ? ? -78.78 33.69 80 11 ALA A 2 ? ? 178.18 156.32 81 11 CYS A 28 ? ? 41.67 76.25 82 11 GLU A 31 ? ? -96.55 -60.81 83 11 ILE A 39 ? ? 62.52 -67.35 84 11 SER A 60 ? ? -146.69 -13.27 85 11 ASN A 81 ? ? 48.51 24.17 86 11 ARG A 90 ? ? 61.13 61.90 87 11 SER A 92 ? ? -78.53 34.12 88 12 CYS A 8 ? ? 47.96 13.27 89 12 CYS A 28 ? ? 40.02 76.45 90 12 ILE A 39 ? ? 62.70 -61.23 91 12 SER A 60 ? ? -146.66 -65.51 92 12 PRO A 70 ? ? -64.99 -177.24 93 12 SER A 92 ? ? -90.17 33.01 94 12 ALA A 93 ? ? -165.90 102.87 95 13 CYS A 8 ? ? 41.02 12.91 96 13 CYS A 28 ? ? 41.12 75.96 97 13 LEU A 30 ? ? -69.90 64.90 98 13 GLU A 31 ? ? -96.24 -75.64 99 13 ILE A 39 ? ? 63.51 -59.94 100 13 SER A 60 ? ? -146.76 -13.45 101 13 PRO A 70 ? ? -63.87 -178.37 102 13 ARG A 90 ? ? 62.15 62.24 103 13 SER A 92 ? ? -79.20 33.20 104 13 ALA A 93 ? ? -166.52 116.20 105 14 CYS A 8 ? ? 54.18 16.24 106 14 CYS A 28 ? ? 29.01 75.72 107 14 GLU A 32 ? ? -150.11 88.65 108 14 ILE A 39 ? ? 62.11 -63.09 109 14 SER A 60 ? ? -147.05 -13.59 110 14 SER A 92 ? ? -78.42 33.31 111 15 ALA A 2 ? ? 173.97 136.53 112 15 CYS A 8 ? ? 58.06 16.26 113 15 CYS A 28 ? ? 41.57 76.03 114 15 ILE A 39 ? ? 62.44 -61.78 115 15 SER A 60 ? ? -147.07 -14.32 116 15 SER A 89 ? ? -111.09 77.51 117 15 ARG A 90 ? ? 66.49 61.86 118 15 SER A 92 ? ? -78.91 34.11 119 15 ALA A 93 ? ? -164.02 110.74 120 16 PRO A 3 ? ? -67.43 -173.61 121 16 CYS A 28 ? ? 41.22 76.03 122 16 GLU A 31 ? ? -96.73 -70.51 123 16 ILE A 39 ? ? 62.51 -55.32 124 16 ASN A 59 ? ? -63.69 73.25 125 16 SER A 60 ? ? -146.82 -29.24 126 16 ARG A 90 ? ? 62.86 62.26 127 16 SER A 92 ? ? -80.08 33.94 128 16 ALA A 93 ? ? -164.24 114.83 129 17 CYS A 8 ? ? 56.69 19.39 130 17 THR A 10 ? ? -29.59 118.54 131 17 CYS A 24 ? ? -111.11 79.83 132 17 CYS A 28 ? ? 41.33 76.37 133 17 GLU A 31 ? ? -87.35 -75.83 134 17 ILE A 39 ? ? 59.91 -62.40 135 17 SER A 60 ? ? -147.23 -13.62 136 17 ARG A 90 ? ? 66.36 61.85 137 17 SER A 92 ? ? -78.70 33.67 138 17 ALA A 93 ? ? -164.28 106.12 139 18 CYS A 8 ? ? 55.98 13.26 140 18 ARG A 16 ? ? -108.94 65.99 141 18 CYS A 28 ? ? 30.76 68.82 142 18 ILE A 39 ? ? 61.88 -65.11 143 18 SER A 60 ? ? -146.92 -16.53 144 18 SER A 92 ? ? -78.63 33.60 145 19 CYS A 8 ? ? 48.25 12.95 146 19 CYS A 28 ? ? 37.60 76.03 147 19 ILE A 39 ? ? 62.46 -62.05 148 19 SER A 60 ? ? -146.79 -13.60 149 19 PRO A 70 ? ? -58.37 174.29 150 19 SER A 92 ? ? -81.59 33.45 151 19 ALA A 93 ? ? -165.70 101.25 152 20 ARG A 16 ? ? -99.37 35.52 153 20 CYS A 28 ? ? 41.15 75.13 154 20 GLU A 31 ? ? -96.53 -66.30 155 20 ILE A 39 ? ? 64.56 -59.08 156 20 SER A 60 ? ? -147.14 -13.86 157 20 SER A 89 ? ? -106.13 76.81 158 20 SER A 92 ? ? -80.23 33.94 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 4 THR A 1 ? ? ALA A 2 ? ? -65.98 2 19 THR A 1 ? ? ALA A 2 ? ? -139.20 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 41 ? ? 0.075 'SIDE CHAIN' 2 1 ARG A 65 ? ? 0.131 'SIDE CHAIN' 3 1 TYR A 67 ? ? 0.079 'SIDE CHAIN' 4 2 ARG A 72 ? ? 0.102 'SIDE CHAIN' 5 3 TYR A 36 ? ? 0.077 'SIDE CHAIN' 6 3 ARG A 72 ? ? 0.118 'SIDE CHAIN' 7 5 ARG A 72 ? ? 0.089 'SIDE CHAIN' 8 6 TYR A 41 ? ? 0.082 'SIDE CHAIN' 9 6 TYR A 67 ? ? 0.071 'SIDE CHAIN' 10 6 ARG A 90 ? ? 0.090 'SIDE CHAIN' 11 8 ARG A 54 ? ? 0.092 'SIDE CHAIN' 12 9 ARG A 16 ? ? 0.086 'SIDE CHAIN' 13 9 TYR A 41 ? ? 0.072 'SIDE CHAIN' 14 10 TYR A 41 ? ? 0.077 'SIDE CHAIN' 15 10 TYR A 67 ? ? 0.066 'SIDE CHAIN' 16 11 ARG A 16 ? ? 0.104 'SIDE CHAIN' 17 11 TYR A 41 ? ? 0.070 'SIDE CHAIN' 18 12 TYR A 75 ? ? 0.084 'SIDE CHAIN' 19 12 ARG A 90 ? ? 0.076 'SIDE CHAIN' 20 13 ARG A 90 ? ? 0.155 'SIDE CHAIN' 21 14 ARG A 54 ? ? 0.155 'SIDE CHAIN' 22 14 ARG A 72 ? ? 0.080 'SIDE CHAIN' 23 15 ARG A 16 ? ? 0.117 'SIDE CHAIN' 24 15 ARG A 72 ? ? 0.107 'SIDE CHAIN' 25 16 ARG A 16 ? ? 0.081 'SIDE CHAIN' 26 16 TYR A 41 ? ? 0.099 'SIDE CHAIN' 27 18 ARG A 72 ? ? 0.099 'SIDE CHAIN' 28 19 TYR A 36 ? ? 0.073 'SIDE CHAIN' 29 20 TYR A 41 ? ? 0.107 'SIDE CHAIN' 30 20 ARG A 90 ? ? 0.151 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1JBI _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1JBI _pdbx_nmr_representative.conformer_id 15 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM LCCL; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '3mg/ml LCCL U-15N; 90% H2O, 10% D2O' '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 301 ambient 4.9 0.1 ? K 2 301 ambient 4.9 0.1 ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY,2D ROESY, 2D DQF-COSY,2D TOCSY' 2 2 2 '3D-15N-separated-NOESY,3D-15N-separated-TOCSY, 1H-15N-HSQC' # _pdbx_nmr_details.entry_id 1JBI _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_refine.entry_id 1JBI _pdbx_nmr_refine.method 'torsion angle dynamics,simulated annealing' _pdbx_nmr_refine.details ;the structures are based on a total of 2532 restraints, 1193 are NOE-derived distance constraints, 270 dihedral angle restraints and 69 residual dipolar coupling restraints ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.5 collection Bruker 1 PROSA 3.4 processing Guntert 2 XEASY 2.6 'data analysis' Guntert 3 DYANA 1.5 'structure solution' Guntert 4 OPAL 2.2 refinement Luginbuhl 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Varian UNITY 800 # _atom_sites.entry_id 1JBI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_