data_1JC7 # _entry.id 1JC7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1JC7 RCSB RCSB013612 WWPDB D_1000013612 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1JB3 _pdbx_database_related.details ;1JB3 is the native un-complexed high resolution structure of NtA ; _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JC7 _pdbx_database_status.recvd_initial_deposition_date 2001-06-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # _audit_author.name 'Stetefeld, J.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'The laminin-binding domain of agrin is structurally related to N-TIMP-1.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 8 _citation.page_first 705 _citation.page_last 709 _citation.year 2001 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11473262 _citation.pdbx_database_id_DOI 10.1038/90422 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Stetefeld, J.' 1 primary 'Jenny, M.' 2 primary 'Schulthess, T.' 3 primary 'Landwehr, R.' 4 primary 'Schumacher, B.' 5 primary 'Frank, S.' 6 primary 'Ruegg, M.A.' 7 primary 'Engel, J.' 8 primary 'Kammerer, R.A.' 9 # _cell.entry_id 1JC7 _cell.length_a 85.306 _cell.length_b 49.899 _cell.length_c 54.328 _cell.angle_alpha 90.00 _cell.angle_beta 118.43 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1JC7 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Agrin 15147.343 1 ? ? 'LAMININ-BINDING DOMAIN' ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;CPERELQRREEEANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGKDIVTHEILLDGGNKVVIGGFGDPLICDNQVSTG DTRIFFVNPAPQYMWPAHRNELMLNSSLMRITLRNLEEVEHCVEEHRKLKA ; _entity_poly.pdbx_seq_one_letter_code_can ;CPERELQRREEEANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGKDIVTHEILLDGGNKVVIGGFGDPLICDNQVSTG DTRIFFVNPAPQYMWPAHRNELMLNSSLMRITLRNLEEVEHCVEEHRKLKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 PRO n 1 3 GLU n 1 4 ARG n 1 5 GLU n 1 6 LEU n 1 7 GLN n 1 8 ARG n 1 9 ARG n 1 10 GLU n 1 11 GLU n 1 12 GLU n 1 13 ALA n 1 14 ASN n 1 15 VAL n 1 16 VAL n 1 17 LEU n 1 18 THR n 1 19 GLY n 1 20 THR n 1 21 VAL n 1 22 GLU n 1 23 GLU n 1 24 ILE n 1 25 MET n 1 26 ASN n 1 27 VAL n 1 28 ASP n 1 29 PRO n 1 30 VAL n 1 31 HIS n 1 32 HIS n 1 33 THR n 1 34 TYR n 1 35 SER n 1 36 CYS n 1 37 LYS n 1 38 VAL n 1 39 ARG n 1 40 VAL n 1 41 TRP n 1 42 ARG n 1 43 TYR n 1 44 LEU n 1 45 LYS n 1 46 GLY n 1 47 LYS n 1 48 ASP n 1 49 ILE n 1 50 VAL n 1 51 THR n 1 52 HIS n 1 53 GLU n 1 54 ILE n 1 55 LEU n 1 56 LEU n 1 57 ASP n 1 58 GLY n 1 59 GLY n 1 60 ASN n 1 61 LYS n 1 62 VAL n 1 63 VAL n 1 64 ILE n 1 65 GLY n 1 66 GLY n 1 67 PHE n 1 68 GLY n 1 69 ASP n 1 70 PRO n 1 71 LEU n 1 72 ILE n 1 73 CYS n 1 74 ASP n 1 75 ASN n 1 76 GLN n 1 77 VAL n 1 78 SER n 1 79 THR n 1 80 GLY n 1 81 ASP n 1 82 THR n 1 83 ARG n 1 84 ILE n 1 85 PHE n 1 86 PHE n 1 87 VAL n 1 88 ASN n 1 89 PRO n 1 90 ALA n 1 91 PRO n 1 92 GLN n 1 93 TYR n 1 94 MET n 1 95 TRP n 1 96 PRO n 1 97 ALA n 1 98 HIS n 1 99 ARG n 1 100 ASN n 1 101 GLU n 1 102 LEU n 1 103 MET n 1 104 LEU n 1 105 ASN n 1 106 SER n 1 107 SER n 1 108 LEU n 1 109 MET n 1 110 ARG n 1 111 ILE n 1 112 THR n 1 113 LEU n 1 114 ARG n 1 115 ASN n 1 116 LEU n 1 117 GLU n 1 118 GLU n 1 119 VAL n 1 120 GLU n 1 121 HIS n 1 122 CYS n 1 123 VAL n 1 124 GLU n 1 125 GLU n 1 126 HIS n 1 127 ARG n 1 128 LYS n 1 129 LEU n 1 130 LYS n 1 131 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q90685_CHICK _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CPERELQRREEEANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGKDIVTHEILLDGGNKVVIGGFGDPLICDNQVSTG DTRIFFVNPAPQYMWPAHRNELMLNSSLMRITLRNLEEVEHCVEEHRKLLA ; _struct_ref.pdbx_align_begin 26 _struct_ref.pdbx_db_accession Q90685 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JC7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q90685 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1JC7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.36 _exptl_crystal.density_percent_sol 63.34 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pdbx_details 'PEG4000, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.847 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE X11' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, Hamburg' _diffrn_source.pdbx_synchrotron_beamline X11 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.847 # _reflns.entry_id 1JC7 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs ? _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 26.4 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1JC7 _refine.ls_number_reflns_obs 5189 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF 664563.50 _refine.pdbx_data_cutoff_low_absF 0.00 _refine.ls_d_res_low 27.92 _refine.ls_d_res_high 2.73 _refine.ls_percent_reflns_obs 95.1 _refine.ls_R_factor_obs 0.207 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.207 _refine.ls_R_factor_R_free 0.249 _refine.ls_R_factor_R_free_error 0.011 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.4 _refine.ls_number_reflns_R_free 539 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 35.9 _refine.aniso_B[1][1] 4.93 _refine.aniso_B[2][2] 3.46 _refine.aniso_B[3][3] -8.39 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.07 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.304 _refine.solvent_model_param_bsol 24.06 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1JC7 _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_sigma_a_obs 0.32 _refine_analyze.Luzzati_d_res_low_obs 30.00 _refine_analyze.Luzzati_coordinate_error_free 0.43 _refine_analyze.Luzzati_sigma_a_free 0.39 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1046 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1047 _refine_hist.d_res_high 2.73 _refine_hist.d_res_low 27.92 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.72 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 2.87 _refine_ls_shell.number_reflns_R_work 459 _refine_ls_shell.R_factor_R_work 0.316 _refine_ls_shell.percent_reflns_obs 54.8 _refine_ls_shell.R_factor_R_free 0.342 _refine_ls_shell.R_factor_R_free_error 0.050 _refine_ls_shell.percent_reflns_R_free 9.3 _refine_ls_shell.number_reflns_R_free 47 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM ION.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1JC7 _struct.title 'The Laminin-Binding Domain of Agrin is Structurally Related to N-TIMP-1' _struct.pdbx_descriptor 'N-terminal Agrin domain complexed with a synthetic peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JC7 _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'NEUROMUSCULAR JUNCTION, AGRIN, INTERACTION COILED-DOIL PROTEINS WITH GLOBULAR PROTEINS, OB-FOLD, TIMP, CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 5 ? GLU A 12 ? GLU A 6 GLU A 13 1 ? 8 HELX_P HELX_P2 2 GLY A 46 ? ILE A 54 ? GLY A 47 ILE A 55 1 ? 9 HELX_P HELX_P3 3 PRO A 91 ? TRP A 95 ? PRO A 92 TRP A 96 5 ? 5 HELX_P HELX_P4 4 THR A 112 ? ARG A 127 ? THR A 113 ARG A 128 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 73 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 2 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 74 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.033 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 95 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 96 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 96 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 97 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.10 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 15 ? ASP A 28 ? VAL A 16 ASP A 29 A 2 THR A 33 ? LYS A 45 ? THR A 34 LYS A 46 A 3 LYS A 61 ? PHE A 67 ? LYS A 62 PHE A 68 A 4 LEU A 102 ? MET A 109 ? LEU A 103 MET A 110 A 5 THR A 82 ? PRO A 89 ? THR A 83 PRO A 90 A 6 VAL A 15 ? ASP A 28 ? VAL A 16 ASP A 29 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 28 ? N ASP A 29 O THR A 33 ? O THR A 34 A 2 3 N VAL A 38 ? N VAL A 39 O VAL A 62 ? O VAL A 63 A 3 4 O VAL A 63 ? O VAL A 64 N LEU A 102 ? N LEU A 103 A 4 5 O MET A 109 ? O MET A 110 N ILE A 84 ? N ILE A 85 A 5 6 N VAL A 87 ? N VAL A 88 O VAL A 15 ? O VAL A 16 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE CL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ARG A 4 ? ARG A 5 . ? 1_555 ? 2 AC1 2 SER A 107 ? SER A 108 . ? 1_555 ? # _database_PDB_matrix.entry_id 1JC7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JC7 _atom_sites.fract_transf_matrix[1][1] 0.011723 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006347 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020040 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020931 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 2 2 CYS CYS A . n A 1 2 PRO 2 3 3 PRO PRO A . n A 1 3 GLU 3 4 4 GLU GLU A . n A 1 4 ARG 4 5 5 ARG ARG A . n A 1 5 GLU 5 6 6 GLU GLU A . n A 1 6 LEU 6 7 7 LEU LEU A . n A 1 7 GLN 7 8 8 GLN GLN A . n A 1 8 ARG 8 9 9 ARG ARG A . n A 1 9 ARG 9 10 10 ARG ARG A . n A 1 10 GLU 10 11 11 GLU GLU A . n A 1 11 GLU 11 12 12 GLU GLU A . n A 1 12 GLU 12 13 13 GLU GLU A . n A 1 13 ALA 13 14 14 ALA ALA A . n A 1 14 ASN 14 15 15 ASN ASN A . n A 1 15 VAL 15 16 16 VAL VAL A . n A 1 16 VAL 16 17 17 VAL VAL A . n A 1 17 LEU 17 18 18 LEU LEU A . n A 1 18 THR 18 19 19 THR THR A . n A 1 19 GLY 19 20 20 GLY GLY A . n A 1 20 THR 20 21 21 THR THR A . n A 1 21 VAL 21 22 22 VAL VAL A . n A 1 22 GLU 22 23 23 GLU GLU A . n A 1 23 GLU 23 24 24 GLU GLU A . n A 1 24 ILE 24 25 25 ILE ILE A . n A 1 25 MET 25 26 26 MET MET A . n A 1 26 ASN 26 27 27 ASN ASN A . n A 1 27 VAL 27 28 28 VAL VAL A . n A 1 28 ASP 28 29 29 ASP ASP A . n A 1 29 PRO 29 30 30 PRO PRO A . n A 1 30 VAL 30 31 31 VAL VAL A . n A 1 31 HIS 31 32 32 HIS HIS A . n A 1 32 HIS 32 33 33 HIS HIS A . n A 1 33 THR 33 34 34 THR THR A . n A 1 34 TYR 34 35 35 TYR TYR A . n A 1 35 SER 35 36 36 SER SER A . n A 1 36 CYS 36 37 37 CYS CYS A . n A 1 37 LYS 37 38 38 LYS LYS A . n A 1 38 VAL 38 39 39 VAL VAL A . n A 1 39 ARG 39 40 40 ARG ARG A . n A 1 40 VAL 40 41 41 VAL VAL A . n A 1 41 TRP 41 42 42 TRP TRP A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 TYR 43 44 44 TYR TYR A . n A 1 44 LEU 44 45 45 LEU LEU A . n A 1 45 LYS 45 46 46 LYS LYS A . n A 1 46 GLY 46 47 47 GLY GLY A . n A 1 47 LYS 47 48 48 LYS LYS A . n A 1 48 ASP 48 49 49 ASP ASP A . n A 1 49 ILE 49 50 50 ILE ILE A . n A 1 50 VAL 50 51 51 VAL VAL A . n A 1 51 THR 51 52 52 THR THR A . n A 1 52 HIS 52 53 53 HIS HIS A . n A 1 53 GLU 53 54 54 GLU GLU A . n A 1 54 ILE 54 55 55 ILE ILE A . n A 1 55 LEU 55 56 56 LEU LEU A . n A 1 56 LEU 56 57 57 LEU LEU A . n A 1 57 ASP 57 58 58 ASP ASP A . n A 1 58 GLY 58 59 59 GLY GLY A . n A 1 59 GLY 59 60 60 GLY GLY A . n A 1 60 ASN 60 61 61 ASN ASN A . n A 1 61 LYS 61 62 62 LYS LYS A . n A 1 62 VAL 62 63 63 VAL VAL A . n A 1 63 VAL 63 64 64 VAL VAL A . n A 1 64 ILE 64 65 65 ILE ILE A . n A 1 65 GLY 65 66 66 GLY GLY A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 PHE 67 68 68 PHE PHE A . n A 1 68 GLY 68 69 69 GLY GLY A . n A 1 69 ASP 69 70 70 ASP ASP A . n A 1 70 PRO 70 71 71 PRO PRO A . n A 1 71 LEU 71 72 72 LEU LEU A . n A 1 72 ILE 72 73 73 ILE ILE A . n A 1 73 CYS 73 74 74 CYS CYS A . n A 1 74 ASP 74 75 75 ASP ASP A . n A 1 75 ASN 75 76 76 ASN ASN A . n A 1 76 GLN 76 77 77 GLN GLN A . n A 1 77 VAL 77 78 78 VAL VAL A . n A 1 78 SER 78 79 79 SER SER A . n A 1 79 THR 79 80 80 THR THR A . n A 1 80 GLY 80 81 81 GLY GLY A . n A 1 81 ASP 81 82 82 ASP ASP A . n A 1 82 THR 82 83 83 THR THR A . n A 1 83 ARG 83 84 84 ARG ARG A . n A 1 84 ILE 84 85 85 ILE ILE A . n A 1 85 PHE 85 86 86 PHE PHE A . n A 1 86 PHE 86 87 87 PHE PHE A . n A 1 87 VAL 87 88 88 VAL VAL A . n A 1 88 ASN 88 89 89 ASN ASN A . n A 1 89 PRO 89 90 90 PRO PRO A . n A 1 90 ALA 90 91 91 ALA ALA A . n A 1 91 PRO 91 92 92 PRO PRO A . n A 1 92 GLN 92 93 93 GLN GLN A . n A 1 93 TYR 93 94 94 TYR TYR A . n A 1 94 MET 94 95 95 MET MET A . n A 1 95 TRP 95 96 96 TRP TRP A . n A 1 96 PRO 96 97 97 PRO PRO A . n A 1 97 ALA 97 98 98 ALA ALA A . n A 1 98 HIS 98 99 99 HIS HIS A . n A 1 99 ARG 99 100 100 ARG ARG A . n A 1 100 ASN 100 101 101 ASN ASN A . n A 1 101 GLU 101 102 102 GLU GLU A . n A 1 102 LEU 102 103 103 LEU LEU A . n A 1 103 MET 103 104 104 MET MET A . n A 1 104 LEU 104 105 105 LEU LEU A . n A 1 105 ASN 105 106 106 ASN ASN A . n A 1 106 SER 106 107 107 SER SER A . n A 1 107 SER 107 108 108 SER SER A . n A 1 108 LEU 108 109 109 LEU LEU A . n A 1 109 MET 109 110 110 MET MET A . n A 1 110 ARG 110 111 111 ARG ARG A . n A 1 111 ILE 111 112 112 ILE ILE A . n A 1 112 THR 112 113 113 THR THR A . n A 1 113 LEU 113 114 114 LEU LEU A . n A 1 114 ARG 114 115 115 ARG ARG A . n A 1 115 ASN 115 116 116 ASN ASN A . n A 1 116 LEU 116 117 117 LEU LEU A . n A 1 117 GLU 117 118 118 GLU GLU A . n A 1 118 GLU 118 119 119 GLU GLU A . n A 1 119 VAL 119 120 120 VAL VAL A . n A 1 120 GLU 120 121 121 GLU GLU A . n A 1 121 HIS 121 122 122 HIS HIS A . n A 1 122 CYS 122 123 123 CYS CYS A . n A 1 123 VAL 123 124 124 VAL VAL A . n A 1 124 GLU 124 125 125 GLU GLU A . n A 1 125 GLU 125 126 126 GLU GLU A . n A 1 126 HIS 126 127 127 HIS HIS A . n A 1 127 ARG 127 128 128 ARG ARG A . n A 1 128 LYS 128 129 129 LYS LYS A . n A 1 129 LEU 129 130 130 LEU LEU A . n A 1 130 LYS 130 131 ? ? ? A . n A 1 131 ALA 131 132 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-08-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 AMoRE phasing . ? 3 CNS refinement 1.0 ? 4 CCP4 'data scaling' '(SCALA)' ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 26 ? ? -82.97 -150.60 2 1 LYS A 46 ? ? 178.06 143.65 3 1 SER A 108 ? ? -35.59 134.41 4 1 ARG A 128 ? ? -66.26 3.99 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 131 ? A LYS 130 2 1 Y 1 A ALA 132 ? A ALA 131 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CHLORIDE ION' _pdbx_entity_nonpoly.comp_id CL # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CL _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id CL _pdbx_nonpoly_scheme.auth_mon_id CL _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . #