data_1JDM # _entry.id 1JDM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JDM pdb_00001jdm 10.2210/pdb1jdm/pdb RCSB RCSB013656 ? ? WWPDB D_1000013656 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-02-13 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JDM _pdbx_database_status.recvd_initial_deposition_date 2001-06-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Veglia, G.' 1 'Mascioni, A.' 2 # _citation.id primary _citation.title 'Structure and orientation of sarcolipin in lipid environments.' _citation.journal_abbrev Biochemistry _citation.journal_volume 41 _citation.page_first 475 _citation.page_last 482 _citation.year 2002 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11781085 _citation.pdbx_database_id_DOI 10.1021/bi011243m # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mascioni, A.' 1 ? primary 'Karim, C.' 2 ? primary 'Barany, G.' 3 ? primary 'Thomas, D.D.' 4 ? primary 'Veglia, G.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Sarcolipin _entity.formula_weight 3763.559 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGINTRELFLNFTIVLITVILMWLLVRSYQY _entity_poly.pdbx_seq_one_letter_code_can MGINTRELFLNFTIVLITVILMWLLVRSYQY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ILE n 1 4 ASN n 1 5 THR n 1 6 ARG n 1 7 GLU n 1 8 LEU n 1 9 PHE n 1 10 LEU n 1 11 ASN n 1 12 PHE n 1 13 THR n 1 14 ILE n 1 15 VAL n 1 16 LEU n 1 17 ILE n 1 18 THR n 1 19 VAL n 1 20 ILE n 1 21 LEU n 1 22 MET n 1 23 TRP n 1 24 LEU n 1 25 LEU n 1 26 VAL n 1 27 ARG n 1 28 SER n 1 29 TYR n 1 30 GLN n 1 31 TYR n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This sequence occurs naturally in Homo sapiens (humans).' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 TYR 31 31 31 TYR TYR A . n # _exptl.entry_id 1JDM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1JDM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1JDM _struct.title 'NMR Structure of Sarcolipin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JDM _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Helix, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SARCO_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MGINTRELFLNFTIVLITVILMWLLVRSYQY _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession O00631 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JDM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00631 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 31 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 26 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 8 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 26 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 12 O A LEU 21 ? ? H A LEU 25 ? ? 1.57 2 12 O A VAL 15 ? ? OG1 A THR 18 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 3 ? ? 60.78 62.65 2 1 ASN A 4 ? ? -174.54 68.28 3 1 THR A 5 ? ? -52.71 174.02 4 1 LEU A 24 ? ? -135.01 -31.61 5 1 ARG A 27 ? ? -44.36 -72.60 6 1 SER A 28 ? ? -166.73 33.14 7 1 TYR A 29 ? ? -154.38 81.39 8 2 ARG A 6 ? ? 156.06 -9.99 9 2 LEU A 10 ? ? -55.08 -70.25 10 2 ILE A 20 ? ? -64.76 -74.58 11 2 LEU A 24 ? ? -135.02 -32.60 12 2 ARG A 27 ? ? -75.13 -70.61 13 2 SER A 28 ? ? -172.66 44.12 14 2 TYR A 29 ? ? 43.91 27.47 15 2 GLN A 30 ? ? 34.94 -157.10 16 3 ASN A 4 ? ? -61.33 -127.33 17 3 THR A 5 ? ? 46.44 -171.48 18 3 GLU A 7 ? ? 11.91 106.35 19 3 LEU A 8 ? ? 85.97 -37.85 20 3 ILE A 14 ? ? -85.58 -73.30 21 3 ILE A 20 ? ? -62.80 -76.47 22 3 LEU A 24 ? ? -133.52 -47.41 23 3 ARG A 27 ? ? -39.66 -34.99 24 4 ARG A 6 ? ? -98.82 -101.19 25 4 GLU A 7 ? ? 47.66 -86.43 26 4 LEU A 10 ? ? -47.05 -84.68 27 4 LEU A 24 ? ? -127.57 -66.83 28 4 ARG A 27 ? ? -107.89 47.57 29 4 SER A 28 ? ? -165.48 31.42 30 4 TYR A 29 ? ? -152.13 -102.31 31 5 ASN A 4 ? ? 45.37 -142.30 32 5 THR A 5 ? ? 48.41 -112.62 33 5 ARG A 6 ? ? 167.83 -31.61 34 5 MET A 22 ? ? -71.11 -70.37 35 5 LEU A 24 ? ? -134.21 -61.86 36 5 ARG A 27 ? ? -61.42 -82.97 37 5 SER A 28 ? ? 66.91 65.19 38 5 TYR A 29 ? ? -118.55 62.53 39 5 GLN A 30 ? ? 179.88 42.49 40 6 ILE A 3 ? ? -88.01 -105.19 41 6 THR A 5 ? ? -75.53 -167.33 42 6 ARG A 6 ? ? -175.73 74.64 43 6 GLU A 7 ? ? 68.72 67.56 44 6 ILE A 20 ? ? -58.77 -74.12 45 6 LEU A 24 ? ? -94.70 -71.34 46 7 ASN A 4 ? ? 66.28 -72.84 47 7 ARG A 6 ? ? 179.37 -49.38 48 7 GLU A 7 ? ? 40.26 -150.25 49 7 LEU A 8 ? ? -89.01 49.62 50 7 ILE A 14 ? ? -88.50 -71.65 51 7 SER A 28 ? ? -124.66 -85.98 52 7 TYR A 29 ? ? 171.05 57.04 53 7 GLN A 30 ? ? -178.27 140.90 54 8 ASN A 4 ? ? 50.59 85.94 55 8 THR A 5 ? ? 43.91 -156.73 56 8 ARG A 6 ? ? 83.74 -46.69 57 8 LEU A 8 ? ? 26.35 42.71 58 8 SER A 28 ? ? 67.85 65.73 59 8 TYR A 29 ? ? -37.82 -39.81 60 8 GLN A 30 ? ? 144.19 -174.37 61 9 ILE A 3 ? ? 42.39 -169.83 62 9 ASN A 4 ? ? -68.51 68.41 63 9 THR A 5 ? ? 53.86 -102.51 64 9 ARG A 6 ? ? 45.81 78.60 65 9 GLU A 7 ? ? -46.52 -71.50 66 9 LEU A 10 ? ? -77.60 -82.05 67 9 LEU A 24 ? ? -106.13 -71.46 68 9 TYR A 29 ? ? -177.81 -30.94 69 10 ILE A 3 ? ? 43.14 74.51 70 10 ARG A 6 ? ? -172.64 -49.58 71 10 GLU A 7 ? ? 39.46 80.04 72 10 LEU A 8 ? ? 31.68 62.84 73 10 LEU A 24 ? ? -99.79 -69.41 74 11 ILE A 3 ? ? 58.56 -99.77 75 11 ASN A 4 ? ? -177.95 39.10 76 11 THR A 5 ? ? 64.68 -5.48 77 11 ARG A 6 ? ? -94.93 -100.66 78 11 LEU A 10 ? ? -66.18 -70.20 79 11 GLN A 30 ? ? -178.18 50.14 80 12 ILE A 3 ? ? -58.51 -176.15 81 12 ARG A 6 ? ? -109.67 -91.52 82 12 LEU A 10 ? ? -77.26 -72.62 83 12 ILE A 20 ? ? -63.32 -74.37 84 12 LEU A 24 ? ? -123.85 -52.19 85 12 ARG A 27 ? ? -92.96 45.17 86 12 TYR A 29 ? ? 81.59 -11.92 87 12 GLN A 30 ? ? 67.83 146.77 88 13 ILE A 3 ? ? 64.37 129.48 89 13 ASN A 4 ? ? 60.87 -81.90 90 13 THR A 5 ? ? -123.02 -163.42 91 13 ARG A 6 ? ? -143.10 -46.36 92 13 LEU A 8 ? ? -90.05 36.48 93 13 GLN A 30 ? ? -176.89 -171.82 94 14 ASN A 4 ? ? 62.18 -80.13 95 14 ARG A 6 ? ? 63.07 90.40 96 14 LEU A 8 ? ? 35.99 34.65 97 14 LEU A 10 ? ? -60.95 -74.46 98 14 TYR A 29 ? ? 80.49 -48.87 99 14 GLN A 30 ? ? -83.63 -127.44 100 15 ILE A 3 ? ? -57.85 -177.37 101 15 ASN A 4 ? ? -116.83 -93.99 102 15 THR A 5 ? ? 25.89 -133.99 103 15 ARG A 6 ? ? 69.69 -45.60 104 15 GLU A 7 ? ? 67.26 -62.31 105 15 LEU A 24 ? ? -122.14 -61.37 106 15 SER A 28 ? ? -168.18 -78.84 107 15 TYR A 29 ? ? 166.87 43.57 108 15 GLN A 30 ? ? -51.73 -179.80 109 16 ILE A 3 ? ? 63.81 128.01 110 16 ASN A 4 ? ? 66.16 155.34 111 16 THR A 5 ? ? -49.14 -96.34 112 16 ARG A 6 ? ? 38.30 72.30 113 16 LEU A 10 ? ? -59.61 -81.31 114 16 LEU A 24 ? ? -121.26 -59.19 115 16 ARG A 27 ? ? -91.00 32.67 116 16 SER A 28 ? ? -176.83 -71.15 117 16 TYR A 29 ? ? 79.95 102.29 118 16 GLN A 30 ? ? 82.52 -0.52 # _pdbx_nmr_ensemble.entry_id 1JDM _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 16 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1JDM _pdbx_nmr_representative.conformer_id 7 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.7 mM Sarcolipin; 20mM phosphate buffer; 600 mM SDS; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 TOCSY # _pdbx_nmr_refine.entry_id 1JDM _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1C collection Varian 1 NMRPipe 1.8 processing Delaglio 2 Sparky 3.98 'data analysis' 'Thomas, J.' 3 CNS 1.0 refinement Brunger 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 GLN N N N N 45 GLN CA C N S 46 GLN C C N N 47 GLN O O N N 48 GLN CB C N N 49 GLN CG C N N 50 GLN CD C N N 51 GLN OE1 O N N 52 GLN NE2 N N N 53 GLN OXT O N N 54 GLN H H N N 55 GLN H2 H N N 56 GLN HA H N N 57 GLN HB2 H N N 58 GLN HB3 H N N 59 GLN HG2 H N N 60 GLN HG3 H N N 61 GLN HE21 H N N 62 GLN HE22 H N N 63 GLN HXT H N N 64 GLU N N N N 65 GLU CA C N S 66 GLU C C N N 67 GLU O O N N 68 GLU CB C N N 69 GLU CG C N N 70 GLU CD C N N 71 GLU OE1 O N N 72 GLU OE2 O N N 73 GLU OXT O N N 74 GLU H H N N 75 GLU H2 H N N 76 GLU HA H N N 77 GLU HB2 H N N 78 GLU HB3 H N N 79 GLU HG2 H N N 80 GLU HG3 H N N 81 GLU HE2 H N N 82 GLU HXT H N N 83 GLY N N N N 84 GLY CA C N N 85 GLY C C N N 86 GLY O O N N 87 GLY OXT O N N 88 GLY H H N N 89 GLY H2 H N N 90 GLY HA2 H N N 91 GLY HA3 H N N 92 GLY HXT H N N 93 ILE N N N N 94 ILE CA C N S 95 ILE C C N N 96 ILE O O N N 97 ILE CB C N S 98 ILE CG1 C N N 99 ILE CG2 C N N 100 ILE CD1 C N N 101 ILE OXT O N N 102 ILE H H N N 103 ILE H2 H N N 104 ILE HA H N N 105 ILE HB H N N 106 ILE HG12 H N N 107 ILE HG13 H N N 108 ILE HG21 H N N 109 ILE HG22 H N N 110 ILE HG23 H N N 111 ILE HD11 H N N 112 ILE HD12 H N N 113 ILE HD13 H N N 114 ILE HXT H N N 115 LEU N N N N 116 LEU CA C N S 117 LEU C C N N 118 LEU O O N N 119 LEU CB C N N 120 LEU CG C N N 121 LEU CD1 C N N 122 LEU CD2 C N N 123 LEU OXT O N N 124 LEU H H N N 125 LEU H2 H N N 126 LEU HA H N N 127 LEU HB2 H N N 128 LEU HB3 H N N 129 LEU HG H N N 130 LEU HD11 H N N 131 LEU HD12 H N N 132 LEU HD13 H N N 133 LEU HD21 H N N 134 LEU HD22 H N N 135 LEU HD23 H N N 136 LEU HXT H N N 137 MET N N N N 138 MET CA C N S 139 MET C C N N 140 MET O O N N 141 MET CB C N N 142 MET CG C N N 143 MET SD S N N 144 MET CE C N N 145 MET OXT O N N 146 MET H H N N 147 MET H2 H N N 148 MET HA H N N 149 MET HB2 H N N 150 MET HB3 H N N 151 MET HG2 H N N 152 MET HG3 H N N 153 MET HE1 H N N 154 MET HE2 H N N 155 MET HE3 H N N 156 MET HXT H N N 157 PHE N N N N 158 PHE CA C N S 159 PHE C C N N 160 PHE O O N N 161 PHE CB C N N 162 PHE CG C Y N 163 PHE CD1 C Y N 164 PHE CD2 C Y N 165 PHE CE1 C Y N 166 PHE CE2 C Y N 167 PHE CZ C Y N 168 PHE OXT O N N 169 PHE H H N N 170 PHE H2 H N N 171 PHE HA H N N 172 PHE HB2 H N N 173 PHE HB3 H N N 174 PHE HD1 H N N 175 PHE HD2 H N N 176 PHE HE1 H N N 177 PHE HE2 H N N 178 PHE HZ H N N 179 PHE HXT H N N 180 SER N N N N 181 SER CA C N S 182 SER C C N N 183 SER O O N N 184 SER CB C N N 185 SER OG O N N 186 SER OXT O N N 187 SER H H N N 188 SER H2 H N N 189 SER HA H N N 190 SER HB2 H N N 191 SER HB3 H N N 192 SER HG H N N 193 SER HXT H N N 194 THR N N N N 195 THR CA C N S 196 THR C C N N 197 THR O O N N 198 THR CB C N R 199 THR OG1 O N N 200 THR CG2 C N N 201 THR OXT O N N 202 THR H H N N 203 THR H2 H N N 204 THR HA H N N 205 THR HB H N N 206 THR HG1 H N N 207 THR HG21 H N N 208 THR HG22 H N N 209 THR HG23 H N N 210 THR HXT H N N 211 TRP N N N N 212 TRP CA C N S 213 TRP C C N N 214 TRP O O N N 215 TRP CB C N N 216 TRP CG C Y N 217 TRP CD1 C Y N 218 TRP CD2 C Y N 219 TRP NE1 N Y N 220 TRP CE2 C Y N 221 TRP CE3 C Y N 222 TRP CZ2 C Y N 223 TRP CZ3 C Y N 224 TRP CH2 C Y N 225 TRP OXT O N N 226 TRP H H N N 227 TRP H2 H N N 228 TRP HA H N N 229 TRP HB2 H N N 230 TRP HB3 H N N 231 TRP HD1 H N N 232 TRP HE1 H N N 233 TRP HE3 H N N 234 TRP HZ2 H N N 235 TRP HZ3 H N N 236 TRP HH2 H N N 237 TRP HXT H N N 238 TYR N N N N 239 TYR CA C N S 240 TYR C C N N 241 TYR O O N N 242 TYR CB C N N 243 TYR CG C Y N 244 TYR CD1 C Y N 245 TYR CD2 C Y N 246 TYR CE1 C Y N 247 TYR CE2 C Y N 248 TYR CZ C Y N 249 TYR OH O N N 250 TYR OXT O N N 251 TYR H H N N 252 TYR H2 H N N 253 TYR HA H N N 254 TYR HB2 H N N 255 TYR HB3 H N N 256 TYR HD1 H N N 257 TYR HD2 H N N 258 TYR HE1 H N N 259 TYR HE2 H N N 260 TYR HH H N N 261 TYR HXT H N N 262 VAL N N N N 263 VAL CA C N S 264 VAL C C N N 265 VAL O O N N 266 VAL CB C N N 267 VAL CG1 C N N 268 VAL CG2 C N N 269 VAL OXT O N N 270 VAL H H N N 271 VAL H2 H N N 272 VAL HA H N N 273 VAL HB H N N 274 VAL HG11 H N N 275 VAL HG12 H N N 276 VAL HG13 H N N 277 VAL HG21 H N N 278 VAL HG22 H N N 279 VAL HG23 H N N 280 VAL HXT H N N 281 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 GLN N CA sing N N 43 GLN N H sing N N 44 GLN N H2 sing N N 45 GLN CA C sing N N 46 GLN CA CB sing N N 47 GLN CA HA sing N N 48 GLN C O doub N N 49 GLN C OXT sing N N 50 GLN CB CG sing N N 51 GLN CB HB2 sing N N 52 GLN CB HB3 sing N N 53 GLN CG CD sing N N 54 GLN CG HG2 sing N N 55 GLN CG HG3 sing N N 56 GLN CD OE1 doub N N 57 GLN CD NE2 sing N N 58 GLN NE2 HE21 sing N N 59 GLN NE2 HE22 sing N N 60 GLN OXT HXT sing N N 61 GLU N CA sing N N 62 GLU N H sing N N 63 GLU N H2 sing N N 64 GLU CA C sing N N 65 GLU CA CB sing N N 66 GLU CA HA sing N N 67 GLU C O doub N N 68 GLU C OXT sing N N 69 GLU CB CG sing N N 70 GLU CB HB2 sing N N 71 GLU CB HB3 sing N N 72 GLU CG CD sing N N 73 GLU CG HG2 sing N N 74 GLU CG HG3 sing N N 75 GLU CD OE1 doub N N 76 GLU CD OE2 sing N N 77 GLU OE2 HE2 sing N N 78 GLU OXT HXT sing N N 79 GLY N CA sing N N 80 GLY N H sing N N 81 GLY N H2 sing N N 82 GLY CA C sing N N 83 GLY CA HA2 sing N N 84 GLY CA HA3 sing N N 85 GLY C O doub N N 86 GLY C OXT sing N N 87 GLY OXT HXT sing N N 88 ILE N CA sing N N 89 ILE N H sing N N 90 ILE N H2 sing N N 91 ILE CA C sing N N 92 ILE CA CB sing N N 93 ILE CA HA sing N N 94 ILE C O doub N N 95 ILE C OXT sing N N 96 ILE CB CG1 sing N N 97 ILE CB CG2 sing N N 98 ILE CB HB sing N N 99 ILE CG1 CD1 sing N N 100 ILE CG1 HG12 sing N N 101 ILE CG1 HG13 sing N N 102 ILE CG2 HG21 sing N N 103 ILE CG2 HG22 sing N N 104 ILE CG2 HG23 sing N N 105 ILE CD1 HD11 sing N N 106 ILE CD1 HD12 sing N N 107 ILE CD1 HD13 sing N N 108 ILE OXT HXT sing N N 109 LEU N CA sing N N 110 LEU N H sing N N 111 LEU N H2 sing N N 112 LEU CA C sing N N 113 LEU CA CB sing N N 114 LEU CA HA sing N N 115 LEU C O doub N N 116 LEU C OXT sing N N 117 LEU CB CG sing N N 118 LEU CB HB2 sing N N 119 LEU CB HB3 sing N N 120 LEU CG CD1 sing N N 121 LEU CG CD2 sing N N 122 LEU CG HG sing N N 123 LEU CD1 HD11 sing N N 124 LEU CD1 HD12 sing N N 125 LEU CD1 HD13 sing N N 126 LEU CD2 HD21 sing N N 127 LEU CD2 HD22 sing N N 128 LEU CD2 HD23 sing N N 129 LEU OXT HXT sing N N 130 MET N CA sing N N 131 MET N H sing N N 132 MET N H2 sing N N 133 MET CA C sing N N 134 MET CA CB sing N N 135 MET CA HA sing N N 136 MET C O doub N N 137 MET C OXT sing N N 138 MET CB CG sing N N 139 MET CB HB2 sing N N 140 MET CB HB3 sing N N 141 MET CG SD sing N N 142 MET CG HG2 sing N N 143 MET CG HG3 sing N N 144 MET SD CE sing N N 145 MET CE HE1 sing N N 146 MET CE HE2 sing N N 147 MET CE HE3 sing N N 148 MET OXT HXT sing N N 149 PHE N CA sing N N 150 PHE N H sing N N 151 PHE N H2 sing N N 152 PHE CA C sing N N 153 PHE CA CB sing N N 154 PHE CA HA sing N N 155 PHE C O doub N N 156 PHE C OXT sing N N 157 PHE CB CG sing N N 158 PHE CB HB2 sing N N 159 PHE CB HB3 sing N N 160 PHE CG CD1 doub Y N 161 PHE CG CD2 sing Y N 162 PHE CD1 CE1 sing Y N 163 PHE CD1 HD1 sing N N 164 PHE CD2 CE2 doub Y N 165 PHE CD2 HD2 sing N N 166 PHE CE1 CZ doub Y N 167 PHE CE1 HE1 sing N N 168 PHE CE2 CZ sing Y N 169 PHE CE2 HE2 sing N N 170 PHE CZ HZ sing N N 171 PHE OXT HXT sing N N 172 SER N CA sing N N 173 SER N H sing N N 174 SER N H2 sing N N 175 SER CA C sing N N 176 SER CA CB sing N N 177 SER CA HA sing N N 178 SER C O doub N N 179 SER C OXT sing N N 180 SER CB OG sing N N 181 SER CB HB2 sing N N 182 SER CB HB3 sing N N 183 SER OG HG sing N N 184 SER OXT HXT sing N N 185 THR N CA sing N N 186 THR N H sing N N 187 THR N H2 sing N N 188 THR CA C sing N N 189 THR CA CB sing N N 190 THR CA HA sing N N 191 THR C O doub N N 192 THR C OXT sing N N 193 THR CB OG1 sing N N 194 THR CB CG2 sing N N 195 THR CB HB sing N N 196 THR OG1 HG1 sing N N 197 THR CG2 HG21 sing N N 198 THR CG2 HG22 sing N N 199 THR CG2 HG23 sing N N 200 THR OXT HXT sing N N 201 TRP N CA sing N N 202 TRP N H sing N N 203 TRP N H2 sing N N 204 TRP CA C sing N N 205 TRP CA CB sing N N 206 TRP CA HA sing N N 207 TRP C O doub N N 208 TRP C OXT sing N N 209 TRP CB CG sing N N 210 TRP CB HB2 sing N N 211 TRP CB HB3 sing N N 212 TRP CG CD1 doub Y N 213 TRP CG CD2 sing Y N 214 TRP CD1 NE1 sing Y N 215 TRP CD1 HD1 sing N N 216 TRP CD2 CE2 doub Y N 217 TRP CD2 CE3 sing Y N 218 TRP NE1 CE2 sing Y N 219 TRP NE1 HE1 sing N N 220 TRP CE2 CZ2 sing Y N 221 TRP CE3 CZ3 doub Y N 222 TRP CE3 HE3 sing N N 223 TRP CZ2 CH2 doub Y N 224 TRP CZ2 HZ2 sing N N 225 TRP CZ3 CH2 sing Y N 226 TRP CZ3 HZ3 sing N N 227 TRP CH2 HH2 sing N N 228 TRP OXT HXT sing N N 229 TYR N CA sing N N 230 TYR N H sing N N 231 TYR N H2 sing N N 232 TYR CA C sing N N 233 TYR CA CB sing N N 234 TYR CA HA sing N N 235 TYR C O doub N N 236 TYR C OXT sing N N 237 TYR CB CG sing N N 238 TYR CB HB2 sing N N 239 TYR CB HB3 sing N N 240 TYR CG CD1 doub Y N 241 TYR CG CD2 sing Y N 242 TYR CD1 CE1 sing Y N 243 TYR CD1 HD1 sing N N 244 TYR CD2 CE2 doub Y N 245 TYR CD2 HD2 sing N N 246 TYR CE1 CZ doub Y N 247 TYR CE1 HE1 sing N N 248 TYR CE2 CZ sing Y N 249 TYR CE2 HE2 sing N N 250 TYR CZ OH sing N N 251 TYR OH HH sing N N 252 TYR OXT HXT sing N N 253 VAL N CA sing N N 254 VAL N H sing N N 255 VAL N H2 sing N N 256 VAL CA C sing N N 257 VAL CA CB sing N N 258 VAL CA HA sing N N 259 VAL C O doub N N 260 VAL C OXT sing N N 261 VAL CB CG1 sing N N 262 VAL CB CG2 sing N N 263 VAL CB HB sing N N 264 VAL CG1 HG11 sing N N 265 VAL CG1 HG12 sing N N 266 VAL CG1 HG13 sing N N 267 VAL CG2 HG21 sing N N 268 VAL CG2 HG22 sing N N 269 VAL CG2 HG23 sing N N 270 VAL OXT HXT sing N N 271 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1JDM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #