data_1JE4 # _entry.id 1JE4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JE4 pdb_00001je4 10.2210/pdb1je4/pdb RCSB RCSB013670 ? ? WWPDB D_1000013670 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1HUM '1HUM is the dimeric MIP-1beta wild-type protein.' unspecified PDB 1VMP '1VMP binds to CCR5 which is a natural receptor of MIP-1beta.' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JE4 _pdbx_database_status.recvd_initial_deposition_date 2001-06-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, S.' 1 'Jao, S.' 2 'Laurence, J.S.' 3 'LiWang, P.J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural comparison of monomeric variants of the chemokine MIP-1beta having differing ability to bind the receptor CCR5.' Biochemistry 40 10782 10791 2001 BICHAW US 0006-2960 0033 ? 11535053 10.1021/bi011065x 1 'CC chemokine MIP-1beta can function as a monomer and depends on Phe13 for receptor binding' Biochemistry 39 3401 3409 2000 BICHAW US 0006-2960 0033 ? ? 10.1021/bi9923196 2 'High-resolution solution structure of the beta chemokine hMIP-1beta by multidimensional NMR' Science 263 1762 1767 1994 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, S.' 1 ? primary 'Jao, S.' 2 ? primary 'Laurence, J.S.' 3 ? primary 'LiWang, P.J.' 4 ? 1 'Laurence, J.S.' 5 ? 1 'Blanpain, C.' 6 ? 1 'Burgner, J.W.' 7 ? 1 'Parmentier, M.' 8 ? 1 'LiWang, P.J.' 9 ? 2 'Lodi, P.J.' 10 ? 2 'Garrett, D.S.' 11 ? 2 'Kuszewski, J.' 12 ? 2 'Tsang, M.L.' 13 ? 2 'Weatherbee, J.A.' 14 ? 2 'Leonard, W.J.' 15 ? 2 'Gronenborn, A.M.' 16 ? 2 'Clore, G.M.' 17 ? # _cell.entry_id 1JE4 _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'macrophage inflammatory protein 1-beta' _entity.formula_weight 7748.646 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation F13A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MIP-1beta, T-CELL ACTIVATION PROTEIN 2, ACT-2, LYMPHOCYTE ACTIVATION GENE-1 PROTEIN, LAG-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code APMGSDPPTACCASYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN _entity_poly.pdbx_seq_one_letter_code_can APMGSDPPTACCASYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 ASP n 1 7 PRO n 1 8 PRO n 1 9 THR n 1 10 ALA n 1 11 CYS n 1 12 CYS n 1 13 ALA n 1 14 SER n 1 15 TYR n 1 16 THR n 1 17 ALA n 1 18 ARG n 1 19 LYS n 1 20 LEU n 1 21 PRO n 1 22 ARG n 1 23 ASN n 1 24 PHE n 1 25 VAL n 1 26 VAL n 1 27 ASP n 1 28 TYR n 1 29 TYR n 1 30 GLU n 1 31 THR n 1 32 SER n 1 33 SER n 1 34 LEU n 1 35 CYS n 1 36 SER n 1 37 GLN n 1 38 PRO n 1 39 ALA n 1 40 VAL n 1 41 VAL n 1 42 PHE n 1 43 GLN n 1 44 THR n 1 45 LYS n 1 46 ARG n 1 47 SER n 1 48 LYS n 1 49 GLN n 1 50 VAL n 1 51 CYS n 1 52 ALA n 1 53 ASP n 1 54 PRO n 1 55 SER n 1 56 GLU n 1 57 SER n 1 58 TRP n 1 59 VAL n 1 60 GLN n 1 61 GLU n 1 62 TYR n 1 63 VAL n 1 64 TYR n 1 65 ASP n 1 66 LEU n 1 67 GLU n 1 68 LEU n 1 69 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCL4_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_accession P13236 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JE4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P13236 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 69 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1JE4 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 13 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P13236 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 36 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 13 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 2.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1-2mM MIP-1b F13A U-15N, 13C; 20mM Na-phosphate buffer' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 500 2 ? Varian INOVA 600 # _pdbx_nmr_refine.entry_id 1JE4 _pdbx_nmr_refine.method 'The initial fold was obtained by distance geometry and further refined by simulated annealing.' _pdbx_nmr_refine.details ;The structure is based on a total 940 restraints, 851 distance constraints, 69 dihedral angle restraints, 20 distance restraints for 10 hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1JE4 _pdbx_nmr_details.text 'This structure was determined using standard 3D 15N or 13C edited NMR experiments.' # _pdbx_nmr_ensemble.entry_id 1JE4 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1JE4 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe ? processing Delaglio 1 CNS 1.0 'structure solution' Brunger 2 CNS 1.0 refinement Brunger 3 # _exptl.entry_id 1JE4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1JE4 _struct.title 'Solution structure of the monomeric variant of the chemokine MIP-1beta' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1JE4 _struct_keywords.pdbx_keywords 'ANTIVIRAL PROTEIN' _struct_keywords.text 'MIP-1beta, chemokine, macrophage inflammatory protein, ANTIVIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 21 ? ASN A 23 ? PRO A 21 ASN A 23 5 ? 3 HELX_P HELX_P2 2 GLU A 56 ? LEU A 68 ? GLU A 56 LEU A 68 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 11 A CYS 35 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 12 A CYS 51 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 25 ? GLU A 30 ? VAL A 25 GLU A 30 A 2 VAL A 40 ? THR A 44 ? VAL A 40 THR A 44 A 3 CYS A 51 ? ALA A 52 ? CYS A 51 ALA A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 29 ? O TYR A 29 N VAL A 41 ? N VAL A 41 A 2 3 N VAL A 40 ? N VAL A 40 O ALA A 52 ? O ALA A 52 # _database_PDB_matrix.entry_id 1JE4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JE4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASN 69 69 69 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-10-03 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 6 ? ? -147.62 58.19 2 1 ALA A 10 ? ? -165.58 32.26 3 1 ALA A 17 ? ? -97.14 37.86 4 1 PHE A 24 ? ? -97.26 30.74 5 1 VAL A 26 ? ? -90.03 -64.25 6 1 SER A 32 ? ? -60.33 -170.09 7 1 ASP A 53 ? ? -57.79 109.08 #