data_1JJS # _entry.id 1JJS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JJS pdb_00001jjs 10.2210/pdb1jjs/pdb RCSB RCSB013855 ? ? WWPDB D_1000013855 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-10-03 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JJS _pdbx_database_status.recvd_initial_deposition_date 2001-07-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lin, C.H.' 1 'Hare, B.J.' 2 'Wagner, G.' 3 'Harrison, S.C.' 4 'Maniatis, T.' 5 'Fraenkel, E.' 6 # _citation.id primary _citation.title 'A small domain of CBP/p300 binds diverse proteins: solution structure and functional studies.' _citation.journal_abbrev Mol.Cell _citation.journal_volume 8 _citation.page_first 581 _citation.page_last 590 _citation.year 2001 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11583620 _citation.pdbx_database_id_DOI '10.1016/S1097-2765(01)00333-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lin, C.H.' 1 ? primary 'Hare, B.J.' 2 ? primary 'Wagner, G.' 3 ? primary 'Harrison, S.C.' 4 ? primary 'Maniatis, T.' 5 ? primary 'Fraenkel, E.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CREB-BINDING PROTEIN' _entity.formula_weight 5584.497 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAHMALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVAN _entity_poly.pdbx_seq_one_letter_code_can GAHMALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVAN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 LEU n 1 7 GLN n 1 8 ASP n 1 9 LEU n 1 10 LEU n 1 11 ARG n 1 12 THR n 1 13 LEU n 1 14 LYS n 1 15 SER n 1 16 PRO n 1 17 SER n 1 18 SER n 1 19 PRO n 1 20 GLN n 1 21 GLN n 1 22 GLN n 1 23 GLN n 1 24 GLN n 1 25 VAL n 1 26 LEU n 1 27 ASN n 1 28 ILE n 1 29 LEU n 1 30 LYS n 1 31 SER n 1 32 ASN n 1 33 PRO n 1 34 GLN n 1 35 LEU n 1 36 MET n 1 37 ALA n 1 38 ALA n 1 39 PHE n 1 40 ILE n 1 41 LYS n 1 42 GLN n 1 43 ARG n 1 44 THR n 1 45 ALA n 1 46 LYS n 1 47 TYR n 1 48 VAL n 1 49 ALA n 1 50 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene CBP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 MET 4 4 ? ? ? A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLN 21 21 ? ? ? A . n A 1 22 GLN 22 22 ? ? ? A . n A 1 23 GLN 23 23 ? ? ? A . n A 1 24 GLN 24 24 ? ? ? A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ASN 50 50 50 ASN ASN A . n # _cell.entry_id 1JJS _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _exptl.entry_id 1JJS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1JJS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1JJS _struct.title 'NMR Structure of IBiD, A Domain of CBP/p300' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JJS _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Transcription regulation, Coactivator, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBP_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P45481 _struct_ref.pdbx_align_begin 2067 _struct_ref.pdbx_seq_one_letter_code ALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVAN _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JJS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45481 _struct_ref_seq.db_align_beg 2067 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 50 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1JJS GLY A 1 ? UNP P45481 ? ? 'cloning artifact' 1 1 1 1JJS ALA A 2 ? UNP P45481 ? ? 'cloning artifact' 2 2 1 1JJS HIS A 3 ? UNP P45481 ? ? 'cloning artifact' 3 3 1 1JJS MET A 4 ? UNP P45481 ? ? 'cloning artifact' 4 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 5 ? LYS A 14 ? ALA A 5 LYS A 14 1 ? 10 HELX_P HELX_P2 2 VAL A 25 ? LYS A 30 ? VAL A 25 LYS A 30 1 ? 6 HELX_P HELX_P3 3 GLN A 34 ? PHE A 39 ? GLN A 34 PHE A 39 1 ? 6 HELX_P HELX_P4 4 ILE A 40 ? ARG A 43 ? ILE A 40 ARG A 43 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 8 O A ILE 28 ? ? HG A SER 31 ? ? 1.60 2 9 H A ALA 45 ? ? HE1 A TYR 47 ? ? 1.33 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 9 CE1 A TYR 47 ? ? CZ A TYR 47 ? ? 1.612 1.381 0.231 0.013 N 2 9 CZ A TYR 47 ? ? CE2 A TYR 47 ? ? 1.176 1.381 -0.205 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 9 CD1 A TYR 47 ? ? CE1 A TYR 47 ? ? CZ A TYR 47 ? ? 113.91 119.80 -5.89 0.90 N 2 9 CE1 A TYR 47 ? ? CZ A TYR 47 ? ? OH A TYR 47 ? ? 101.73 120.10 -18.37 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 14 ? ? 49.07 -86.07 2 1 SER A 17 ? ? -175.48 -62.92 3 1 SER A 18 ? ? 73.04 54.63 4 1 ASN A 32 ? ? 99.21 -21.70 5 1 ALA A 45 ? ? 73.73 -59.25 6 2 LYS A 14 ? ? 30.26 62.76 7 2 SER A 15 ? ? 55.01 71.35 8 2 SER A 17 ? ? -139.46 -81.29 9 2 SER A 18 ? ? -169.03 -64.24 10 2 PRO A 19 ? ? -54.28 101.92 11 2 ASN A 32 ? ? 92.85 -11.88 12 2 THR A 44 ? ? -121.29 -52.05 13 2 ALA A 45 ? ? 101.85 -55.19 14 3 LYS A 14 ? ? 46.13 -86.44 15 3 ASN A 32 ? ? 95.63 -15.29 16 3 ALA A 45 ? ? 90.68 -61.11 17 3 LYS A 46 ? ? -84.85 32.93 18 3 ALA A 49 ? ? -106.06 58.32 19 4 LYS A 14 ? ? 47.09 -86.21 20 4 SER A 17 ? ? 60.90 167.02 21 4 PRO A 19 ? ? -85.48 -77.73 22 4 ASN A 32 ? ? 95.12 -13.56 23 4 THR A 44 ? ? -124.47 -63.16 24 4 ALA A 45 ? ? 124.62 -65.18 25 4 ALA A 49 ? ? -141.27 43.05 26 5 LYS A 14 ? ? 32.15 35.70 27 5 SER A 15 ? ? 77.67 67.78 28 5 PRO A 16 ? ? -96.18 30.65 29 5 SER A 17 ? ? -174.24 -43.28 30 5 SER A 18 ? ? 70.26 50.63 31 5 ASN A 32 ? ? 98.85 -23.61 32 5 ALA A 45 ? ? 71.40 -62.16 33 5 LYS A 46 ? ? -142.45 11.60 34 6 LYS A 14 ? ? 26.68 71.09 35 6 SER A 18 ? ? 65.07 62.63 36 6 ASN A 32 ? ? 96.82 -17.26 37 6 ALA A 45 ? ? 83.98 -67.02 38 7 LYS A 14 ? ? 21.09 69.14 39 7 SER A 18 ? ? -37.44 94.66 40 7 ASN A 32 ? ? 92.56 -10.58 41 7 ALA A 45 ? ? 88.21 -45.39 42 7 TYR A 47 ? ? -104.16 62.98 43 7 ALA A 49 ? ? -105.62 40.75 44 8 LYS A 14 ? ? 20.94 54.96 45 8 SER A 15 ? ? 73.46 66.52 46 8 SER A 17 ? ? -61.27 -74.10 47 8 SER A 18 ? ? 173.94 -61.17 48 8 PRO A 19 ? ? -42.94 96.36 49 8 ASN A 32 ? ? 108.78 -37.94 50 8 ARG A 43 ? ? -142.52 -28.07 51 8 ALA A 45 ? ? 73.43 -57.40 52 8 TYR A 47 ? ? -36.08 134.53 53 8 ALA A 49 ? ? -151.24 -43.53 54 9 LYS A 14 ? ? 49.71 -83.98 55 9 PRO A 19 ? ? -47.44 94.22 56 9 ASN A 32 ? ? 89.68 -3.61 57 9 ARG A 43 ? ? -143.71 -32.93 58 9 ALA A 45 ? ? 88.08 -42.23 59 9 TYR A 47 ? ? 64.97 64.86 60 9 ALA A 49 ? ? -178.14 -49.28 61 10 LYS A 14 ? ? 47.60 -85.91 62 10 SER A 17 ? ? -178.99 -175.04 63 10 ASN A 32 ? ? 94.82 -15.45 64 10 ARG A 43 ? ? -156.39 -38.88 65 10 ALA A 45 ? ? 103.54 -65.20 66 10 TYR A 47 ? ? 31.41 43.71 67 11 LYS A 14 ? ? 26.24 70.53 68 11 ASN A 32 ? ? 98.43 -20.35 69 11 THR A 44 ? ? -145.46 -21.45 70 11 ALA A 45 ? ? 81.52 -9.53 71 11 ALA A 49 ? ? -108.65 78.63 72 12 LYS A 14 ? ? 51.44 -81.27 73 12 SER A 17 ? ? 70.04 130.28 74 12 SER A 18 ? ? -48.28 104.22 75 12 ASN A 32 ? ? 95.49 -15.39 76 12 ALA A 45 ? ? 85.78 -63.62 77 12 LYS A 46 ? ? -57.16 -107.18 78 12 TYR A 47 ? ? 30.97 62.90 79 12 ALA A 49 ? ? -141.88 21.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 PHE A 39 ? ? 0.074 'SIDE CHAIN' 2 5 PHE A 39 ? ? 0.070 'SIDE CHAIN' 3 6 PHE A 39 ? ? 0.070 'SIDE CHAIN' 4 9 PHE A 39 ? ? 0.060 'SIDE CHAIN' 5 9 TYR A 47 ? ? 0.083 'SIDE CHAIN' 6 10 PHE A 39 ? ? 0.069 'SIDE CHAIN' 7 11 PHE A 39 ? ? 0.078 'SIDE CHAIN' 8 12 PHE A 39 ? ? 0.076 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1JJS _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type '2D NOESY' # _pdbx_nmr_refine.entry_id 1JJS _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal ARIA 1.0 refinement 'Jens Linge, Michael Nilges' 1 XEASY ? 'structure solution' ? 2 TALOS ? 'structure solution' ? 3 ARIA ? 'structure solution' ? 4 CNS ? 'structure solution' ? 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A MET 4 ? A MET 4 5 1 Y 1 A GLN 21 ? A GLN 21 6 1 Y 1 A GLN 22 ? A GLN 22 7 1 Y 1 A GLN 23 ? A GLN 23 8 1 Y 1 A GLN 24 ? A GLN 24 9 2 Y 1 A GLY 1 ? A GLY 1 10 2 Y 1 A ALA 2 ? A ALA 2 11 2 Y 1 A HIS 3 ? A HIS 3 12 2 Y 1 A MET 4 ? A MET 4 13 2 Y 1 A GLN 21 ? A GLN 21 14 2 Y 1 A GLN 22 ? A GLN 22 15 2 Y 1 A GLN 23 ? A GLN 23 16 2 Y 1 A GLN 24 ? A GLN 24 17 3 Y 1 A GLY 1 ? A GLY 1 18 3 Y 1 A ALA 2 ? A ALA 2 19 3 Y 1 A HIS 3 ? A HIS 3 20 3 Y 1 A MET 4 ? A MET 4 21 3 Y 1 A GLN 21 ? A GLN 21 22 3 Y 1 A GLN 22 ? A GLN 22 23 3 Y 1 A GLN 23 ? A GLN 23 24 3 Y 1 A GLN 24 ? A GLN 24 25 4 Y 1 A GLY 1 ? A GLY 1 26 4 Y 1 A ALA 2 ? A ALA 2 27 4 Y 1 A HIS 3 ? A HIS 3 28 4 Y 1 A MET 4 ? A MET 4 29 4 Y 1 A GLN 21 ? A GLN 21 30 4 Y 1 A GLN 22 ? A GLN 22 31 4 Y 1 A GLN 23 ? A GLN 23 32 4 Y 1 A GLN 24 ? A GLN 24 33 5 Y 1 A GLY 1 ? A GLY 1 34 5 Y 1 A ALA 2 ? A ALA 2 35 5 Y 1 A HIS 3 ? A HIS 3 36 5 Y 1 A MET 4 ? A MET 4 37 5 Y 1 A GLN 21 ? A GLN 21 38 5 Y 1 A GLN 22 ? A GLN 22 39 5 Y 1 A GLN 23 ? A GLN 23 40 5 Y 1 A GLN 24 ? A GLN 24 41 6 Y 1 A GLY 1 ? A GLY 1 42 6 Y 1 A ALA 2 ? A ALA 2 43 6 Y 1 A HIS 3 ? A HIS 3 44 6 Y 1 A MET 4 ? A MET 4 45 6 Y 1 A GLN 21 ? A GLN 21 46 6 Y 1 A GLN 22 ? A GLN 22 47 6 Y 1 A GLN 23 ? A GLN 23 48 6 Y 1 A GLN 24 ? A GLN 24 49 7 Y 1 A GLY 1 ? A GLY 1 50 7 Y 1 A ALA 2 ? A ALA 2 51 7 Y 1 A HIS 3 ? A HIS 3 52 7 Y 1 A MET 4 ? A MET 4 53 7 Y 1 A GLN 21 ? A GLN 21 54 7 Y 1 A GLN 22 ? A GLN 22 55 7 Y 1 A GLN 23 ? A GLN 23 56 7 Y 1 A GLN 24 ? A GLN 24 57 8 Y 1 A GLY 1 ? A GLY 1 58 8 Y 1 A ALA 2 ? A ALA 2 59 8 Y 1 A HIS 3 ? A HIS 3 60 8 Y 1 A MET 4 ? A MET 4 61 8 Y 1 A GLN 21 ? A GLN 21 62 8 Y 1 A GLN 22 ? A GLN 22 63 8 Y 1 A GLN 23 ? A GLN 23 64 8 Y 1 A GLN 24 ? A GLN 24 65 9 Y 1 A GLY 1 ? A GLY 1 66 9 Y 1 A ALA 2 ? A ALA 2 67 9 Y 1 A HIS 3 ? A HIS 3 68 9 Y 1 A MET 4 ? A MET 4 69 9 Y 1 A GLN 21 ? A GLN 21 70 9 Y 1 A GLN 22 ? A GLN 22 71 9 Y 1 A GLN 23 ? A GLN 23 72 9 Y 1 A GLN 24 ? A GLN 24 73 10 Y 1 A GLY 1 ? A GLY 1 74 10 Y 1 A ALA 2 ? A ALA 2 75 10 Y 1 A HIS 3 ? A HIS 3 76 10 Y 1 A MET 4 ? A MET 4 77 10 Y 1 A GLN 21 ? A GLN 21 78 10 Y 1 A GLN 22 ? A GLN 22 79 10 Y 1 A GLN 23 ? A GLN 23 80 10 Y 1 A GLN 24 ? A GLN 24 81 11 Y 1 A GLY 1 ? A GLY 1 82 11 Y 1 A ALA 2 ? A ALA 2 83 11 Y 1 A HIS 3 ? A HIS 3 84 11 Y 1 A MET 4 ? A MET 4 85 11 Y 1 A GLN 21 ? A GLN 21 86 11 Y 1 A GLN 22 ? A GLN 22 87 11 Y 1 A GLN 23 ? A GLN 23 88 11 Y 1 A GLN 24 ? A GLN 24 89 12 Y 1 A GLY 1 ? A GLY 1 90 12 Y 1 A ALA 2 ? A ALA 2 91 12 Y 1 A HIS 3 ? A HIS 3 92 12 Y 1 A MET 4 ? A MET 4 93 12 Y 1 A GLN 21 ? A GLN 21 94 12 Y 1 A GLN 22 ? A GLN 22 95 12 Y 1 A GLN 23 ? A GLN 23 96 12 Y 1 A GLN 24 ? A GLN 24 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 HIS N N N N 104 HIS CA C N S 105 HIS C C N N 106 HIS O O N N 107 HIS CB C N N 108 HIS CG C Y N 109 HIS ND1 N Y N 110 HIS CD2 C Y N 111 HIS CE1 C Y N 112 HIS NE2 N Y N 113 HIS OXT O N N 114 HIS H H N N 115 HIS H2 H N N 116 HIS HA H N N 117 HIS HB2 H N N 118 HIS HB3 H N N 119 HIS HD1 H N N 120 HIS HD2 H N N 121 HIS HE1 H N N 122 HIS HE2 H N N 123 HIS HXT H N N 124 ILE N N N N 125 ILE CA C N S 126 ILE C C N N 127 ILE O O N N 128 ILE CB C N S 129 ILE CG1 C N N 130 ILE CG2 C N N 131 ILE CD1 C N N 132 ILE OXT O N N 133 ILE H H N N 134 ILE H2 H N N 135 ILE HA H N N 136 ILE HB H N N 137 ILE HG12 H N N 138 ILE HG13 H N N 139 ILE HG21 H N N 140 ILE HG22 H N N 141 ILE HG23 H N N 142 ILE HD11 H N N 143 ILE HD12 H N N 144 ILE HD13 H N N 145 ILE HXT H N N 146 LEU N N N N 147 LEU CA C N S 148 LEU C C N N 149 LEU O O N N 150 LEU CB C N N 151 LEU CG C N N 152 LEU CD1 C N N 153 LEU CD2 C N N 154 LEU OXT O N N 155 LEU H H N N 156 LEU H2 H N N 157 LEU HA H N N 158 LEU HB2 H N N 159 LEU HB3 H N N 160 LEU HG H N N 161 LEU HD11 H N N 162 LEU HD12 H N N 163 LEU HD13 H N N 164 LEU HD21 H N N 165 LEU HD22 H N N 166 LEU HD23 H N N 167 LEU HXT H N N 168 LYS N N N N 169 LYS CA C N S 170 LYS C C N N 171 LYS O O N N 172 LYS CB C N N 173 LYS CG C N N 174 LYS CD C N N 175 LYS CE C N N 176 LYS NZ N N N 177 LYS OXT O N N 178 LYS H H N N 179 LYS H2 H N N 180 LYS HA H N N 181 LYS HB2 H N N 182 LYS HB3 H N N 183 LYS HG2 H N N 184 LYS HG3 H N N 185 LYS HD2 H N N 186 LYS HD3 H N N 187 LYS HE2 H N N 188 LYS HE3 H N N 189 LYS HZ1 H N N 190 LYS HZ2 H N N 191 LYS HZ3 H N N 192 LYS HXT H N N 193 MET N N N N 194 MET CA C N S 195 MET C C N N 196 MET O O N N 197 MET CB C N N 198 MET CG C N N 199 MET SD S N N 200 MET CE C N N 201 MET OXT O N N 202 MET H H N N 203 MET H2 H N N 204 MET HA H N N 205 MET HB2 H N N 206 MET HB3 H N N 207 MET HG2 H N N 208 MET HG3 H N N 209 MET HE1 H N N 210 MET HE2 H N N 211 MET HE3 H N N 212 MET HXT H N N 213 PHE N N N N 214 PHE CA C N S 215 PHE C C N N 216 PHE O O N N 217 PHE CB C N N 218 PHE CG C Y N 219 PHE CD1 C Y N 220 PHE CD2 C Y N 221 PHE CE1 C Y N 222 PHE CE2 C Y N 223 PHE CZ C Y N 224 PHE OXT O N N 225 PHE H H N N 226 PHE H2 H N N 227 PHE HA H N N 228 PHE HB2 H N N 229 PHE HB3 H N N 230 PHE HD1 H N N 231 PHE HD2 H N N 232 PHE HE1 H N N 233 PHE HE2 H N N 234 PHE HZ H N N 235 PHE HXT H N N 236 PRO N N N N 237 PRO CA C N S 238 PRO C C N N 239 PRO O O N N 240 PRO CB C N N 241 PRO CG C N N 242 PRO CD C N N 243 PRO OXT O N N 244 PRO H H N N 245 PRO HA H N N 246 PRO HB2 H N N 247 PRO HB3 H N N 248 PRO HG2 H N N 249 PRO HG3 H N N 250 PRO HD2 H N N 251 PRO HD3 H N N 252 PRO HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 THR N N N N 268 THR CA C N S 269 THR C C N N 270 THR O O N N 271 THR CB C N R 272 THR OG1 O N N 273 THR CG2 C N N 274 THR OXT O N N 275 THR H H N N 276 THR H2 H N N 277 THR HA H N N 278 THR HB H N N 279 THR HG1 H N N 280 THR HG21 H N N 281 THR HG22 H N N 282 THR HG23 H N N 283 THR HXT H N N 284 TYR N N N N 285 TYR CA C N S 286 TYR C C N N 287 TYR O O N N 288 TYR CB C N N 289 TYR CG C Y N 290 TYR CD1 C Y N 291 TYR CD2 C Y N 292 TYR CE1 C Y N 293 TYR CE2 C Y N 294 TYR CZ C Y N 295 TYR OH O N N 296 TYR OXT O N N 297 TYR H H N N 298 TYR H2 H N N 299 TYR HA H N N 300 TYR HB2 H N N 301 TYR HB3 H N N 302 TYR HD1 H N N 303 TYR HD2 H N N 304 TYR HE1 H N N 305 TYR HE2 H N N 306 TYR HH H N N 307 TYR HXT H N N 308 VAL N N N N 309 VAL CA C N S 310 VAL C C N N 311 VAL O O N N 312 VAL CB C N N 313 VAL CG1 C N N 314 VAL CG2 C N N 315 VAL OXT O N N 316 VAL H H N N 317 VAL H2 H N N 318 VAL HA H N N 319 VAL HB H N N 320 VAL HG11 H N N 321 VAL HG12 H N N 322 VAL HG13 H N N 323 VAL HG21 H N N 324 VAL HG22 H N N 325 VAL HG23 H N N 326 VAL HXT H N N 327 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 HIS N CA sing N N 98 HIS N H sing N N 99 HIS N H2 sing N N 100 HIS CA C sing N N 101 HIS CA CB sing N N 102 HIS CA HA sing N N 103 HIS C O doub N N 104 HIS C OXT sing N N 105 HIS CB CG sing N N 106 HIS CB HB2 sing N N 107 HIS CB HB3 sing N N 108 HIS CG ND1 sing Y N 109 HIS CG CD2 doub Y N 110 HIS ND1 CE1 doub Y N 111 HIS ND1 HD1 sing N N 112 HIS CD2 NE2 sing Y N 113 HIS CD2 HD2 sing N N 114 HIS CE1 NE2 sing Y N 115 HIS CE1 HE1 sing N N 116 HIS NE2 HE2 sing N N 117 HIS OXT HXT sing N N 118 ILE N CA sing N N 119 ILE N H sing N N 120 ILE N H2 sing N N 121 ILE CA C sing N N 122 ILE CA CB sing N N 123 ILE CA HA sing N N 124 ILE C O doub N N 125 ILE C OXT sing N N 126 ILE CB CG1 sing N N 127 ILE CB CG2 sing N N 128 ILE CB HB sing N N 129 ILE CG1 CD1 sing N N 130 ILE CG1 HG12 sing N N 131 ILE CG1 HG13 sing N N 132 ILE CG2 HG21 sing N N 133 ILE CG2 HG22 sing N N 134 ILE CG2 HG23 sing N N 135 ILE CD1 HD11 sing N N 136 ILE CD1 HD12 sing N N 137 ILE CD1 HD13 sing N N 138 ILE OXT HXT sing N N 139 LEU N CA sing N N 140 LEU N H sing N N 141 LEU N H2 sing N N 142 LEU CA C sing N N 143 LEU CA CB sing N N 144 LEU CA HA sing N N 145 LEU C O doub N N 146 LEU C OXT sing N N 147 LEU CB CG sing N N 148 LEU CB HB2 sing N N 149 LEU CB HB3 sing N N 150 LEU CG CD1 sing N N 151 LEU CG CD2 sing N N 152 LEU CG HG sing N N 153 LEU CD1 HD11 sing N N 154 LEU CD1 HD12 sing N N 155 LEU CD1 HD13 sing N N 156 LEU CD2 HD21 sing N N 157 LEU CD2 HD22 sing N N 158 LEU CD2 HD23 sing N N 159 LEU OXT HXT sing N N 160 LYS N CA sing N N 161 LYS N H sing N N 162 LYS N H2 sing N N 163 LYS CA C sing N N 164 LYS CA CB sing N N 165 LYS CA HA sing N N 166 LYS C O doub N N 167 LYS C OXT sing N N 168 LYS CB CG sing N N 169 LYS CB HB2 sing N N 170 LYS CB HB3 sing N N 171 LYS CG CD sing N N 172 LYS CG HG2 sing N N 173 LYS CG HG3 sing N N 174 LYS CD CE sing N N 175 LYS CD HD2 sing N N 176 LYS CD HD3 sing N N 177 LYS CE NZ sing N N 178 LYS CE HE2 sing N N 179 LYS CE HE3 sing N N 180 LYS NZ HZ1 sing N N 181 LYS NZ HZ2 sing N N 182 LYS NZ HZ3 sing N N 183 LYS OXT HXT sing N N 184 MET N CA sing N N 185 MET N H sing N N 186 MET N H2 sing N N 187 MET CA C sing N N 188 MET CA CB sing N N 189 MET CA HA sing N N 190 MET C O doub N N 191 MET C OXT sing N N 192 MET CB CG sing N N 193 MET CB HB2 sing N N 194 MET CB HB3 sing N N 195 MET CG SD sing N N 196 MET CG HG2 sing N N 197 MET CG HG3 sing N N 198 MET SD CE sing N N 199 MET CE HE1 sing N N 200 MET CE HE2 sing N N 201 MET CE HE3 sing N N 202 MET OXT HXT sing N N 203 PHE N CA sing N N 204 PHE N H sing N N 205 PHE N H2 sing N N 206 PHE CA C sing N N 207 PHE CA CB sing N N 208 PHE CA HA sing N N 209 PHE C O doub N N 210 PHE C OXT sing N N 211 PHE CB CG sing N N 212 PHE CB HB2 sing N N 213 PHE CB HB3 sing N N 214 PHE CG CD1 doub Y N 215 PHE CG CD2 sing Y N 216 PHE CD1 CE1 sing Y N 217 PHE CD1 HD1 sing N N 218 PHE CD2 CE2 doub Y N 219 PHE CD2 HD2 sing N N 220 PHE CE1 CZ doub Y N 221 PHE CE1 HE1 sing N N 222 PHE CE2 CZ sing Y N 223 PHE CE2 HE2 sing N N 224 PHE CZ HZ sing N N 225 PHE OXT HXT sing N N 226 PRO N CA sing N N 227 PRO N CD sing N N 228 PRO N H sing N N 229 PRO CA C sing N N 230 PRO CA CB sing N N 231 PRO CA HA sing N N 232 PRO C O doub N N 233 PRO C OXT sing N N 234 PRO CB CG sing N N 235 PRO CB HB2 sing N N 236 PRO CB HB3 sing N N 237 PRO CG CD sing N N 238 PRO CG HG2 sing N N 239 PRO CG HG3 sing N N 240 PRO CD HD2 sing N N 241 PRO CD HD3 sing N N 242 PRO OXT HXT sing N N 243 SER N CA sing N N 244 SER N H sing N N 245 SER N H2 sing N N 246 SER CA C sing N N 247 SER CA CB sing N N 248 SER CA HA sing N N 249 SER C O doub N N 250 SER C OXT sing N N 251 SER CB OG sing N N 252 SER CB HB2 sing N N 253 SER CB HB3 sing N N 254 SER OG HG sing N N 255 SER OXT HXT sing N N 256 THR N CA sing N N 257 THR N H sing N N 258 THR N H2 sing N N 259 THR CA C sing N N 260 THR CA CB sing N N 261 THR CA HA sing N N 262 THR C O doub N N 263 THR C OXT sing N N 264 THR CB OG1 sing N N 265 THR CB CG2 sing N N 266 THR CB HB sing N N 267 THR OG1 HG1 sing N N 268 THR CG2 HG21 sing N N 269 THR CG2 HG22 sing N N 270 THR CG2 HG23 sing N N 271 THR OXT HXT sing N N 272 TYR N CA sing N N 273 TYR N H sing N N 274 TYR N H2 sing N N 275 TYR CA C sing N N 276 TYR CA CB sing N N 277 TYR CA HA sing N N 278 TYR C O doub N N 279 TYR C OXT sing N N 280 TYR CB CG sing N N 281 TYR CB HB2 sing N N 282 TYR CB HB3 sing N N 283 TYR CG CD1 doub Y N 284 TYR CG CD2 sing Y N 285 TYR CD1 CE1 sing Y N 286 TYR CD1 HD1 sing N N 287 TYR CD2 CE2 doub Y N 288 TYR CD2 HD2 sing N N 289 TYR CE1 CZ doub Y N 290 TYR CE1 HE1 sing N N 291 TYR CE2 CZ sing Y N 292 TYR CE2 HE2 sing N N 293 TYR CZ OH sing N N 294 TYR OH HH sing N N 295 TYR OXT HXT sing N N 296 VAL N CA sing N N 297 VAL N H sing N N 298 VAL N H2 sing N N 299 VAL CA C sing N N 300 VAL CA CB sing N N 301 VAL CA HA sing N N 302 VAL C O doub N N 303 VAL C OXT sing N N 304 VAL CB CG1 sing N N 305 VAL CB CG2 sing N N 306 VAL CB HB sing N N 307 VAL CG1 HG11 sing N N 308 VAL CG1 HG12 sing N N 309 VAL CG1 HG13 sing N N 310 VAL CG2 HG21 sing N N 311 VAL CG2 HG22 sing N N 312 VAL CG2 HG23 sing N N 313 VAL OXT HXT sing N N 314 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? ? ? 500 2 ? ? ? 600 3 ? ? ? 750 # _atom_sites.entry_id 1JJS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_