data_1JOK # _entry.id 1JOK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JOK pdb_00001jok 10.2210/pdb1jok/pdb RCSB RCSB014007 ? ? WWPDB D_1000014007 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1JOO 'Averaged structure for unligated Staphylococcal nuclease-H124L' unspecified PDB 1JOQ ;Ensemble structures for Staphylococcal nuclease-H124L in ternary complex with Ca2+ and thymidine-3',5'-bisphosphate ; unspecified PDB 1JOR 'Ensemble structures for unligated Staphylococcal nuclease-H124L' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JOK _pdbx_database_status.recvd_initial_deposition_date 2001-07-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, J.' 1 'Truckses, D.M.' 2 'Abildgaard, F.' 3 'Dzakula, Z.' 4 'Zolnai, Z.' 5 'Markley, J.L.' 6 # _citation.id primary _citation.title ;Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate. ; _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 10 _citation.page_first 143 _citation.page_last 164 _citation.year 1997 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9369015 _citation.pdbx_database_id_DOI 10.1023/A:1018350004729 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, J.' 1 ? primary 'Truckses, D.M.' 2 ? primary 'Abildgaard, F.' 3 ? primary 'Dzakula, Z.' 4 ? primary 'Zolnai, Z.' 5 ? primary 'Markley, J.L.' 6 ? # _cell.entry_id 1JOK _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'staphylococcal nuclease' 16818.340 1 3.1.31.1 H124L 'nuclease A' ? 2 non-polymer syn "THYMIDINE-3',5'-DIPHOSPHATE" 402.188 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'thermonuclease, tnase, micrococcal nuclease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_seq_one_letter_code_can ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 LYS n 1 6 LYS n 1 7 LEU n 1 8 HIS n 1 9 LYS n 1 10 GLU n 1 11 PRO n 1 12 ALA n 1 13 THR n 1 14 LEU n 1 15 ILE n 1 16 LYS n 1 17 ALA n 1 18 ILE n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 THR n 1 23 VAL n 1 24 LYS n 1 25 LEU n 1 26 MET n 1 27 TYR n 1 28 LYS n 1 29 GLY n 1 30 GLN n 1 31 PRO n 1 32 MET n 1 33 THR n 1 34 PHE n 1 35 ARG n 1 36 LEU n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 ASP n 1 41 THR n 1 42 PRO n 1 43 GLU n 1 44 THR n 1 45 LYS n 1 46 HIS n 1 47 PRO n 1 48 LYS n 1 49 LYS n 1 50 GLY n 1 51 VAL n 1 52 GLU n 1 53 LYS n 1 54 TYR n 1 55 GLY n 1 56 PRO n 1 57 GLU n 1 58 ALA n 1 59 SER n 1 60 ALA n 1 61 PHE n 1 62 THR n 1 63 LYS n 1 64 LYS n 1 65 MET n 1 66 VAL n 1 67 GLU n 1 68 ASN n 1 69 ALA n 1 70 LYS n 1 71 LYS n 1 72 ILE n 1 73 GLU n 1 74 VAL n 1 75 GLU n 1 76 PHE n 1 77 ASP n 1 78 LYS n 1 79 GLY n 1 80 GLN n 1 81 ARG n 1 82 THR n 1 83 ASP n 1 84 LYS n 1 85 TYR n 1 86 GLY n 1 87 ARG n 1 88 GLY n 1 89 LEU n 1 90 ALA n 1 91 TYR n 1 92 ILE n 1 93 TYR n 1 94 ALA n 1 95 ASP n 1 96 GLY n 1 97 LYS n 1 98 MET n 1 99 VAL n 1 100 ASN n 1 101 GLU n 1 102 ALA n 1 103 LEU n 1 104 VAL n 1 105 ARG n 1 106 GLN n 1 107 GLY n 1 108 LEU n 1 109 ALA n 1 110 LYS n 1 111 VAL n 1 112 ALA n 1 113 TYR n 1 114 VAL n 1 115 TYR n 1 116 LYS n 1 117 PRO n 1 118 ASN n 1 119 ASN n 1 120 THR n 1 121 HIS n 1 122 GLU n 1 123 GLN n 1 124 LEU n 1 125 LEU n 1 126 ARG n 1 127 LYS n 1 128 SER n 1 129 GLU n 1 130 ALA n 1 131 GLN n 1 132 ALA n 1 133 LYS n 1 134 LYS n 1 135 GLU n 1 136 LYS n 1 137 LEU n 1 138 ASN n 1 139 ILE n 1 140 TRP n 1 141 SER n 1 142 GLU n 1 143 ASP n 1 144 ASN n 1 145 ALA n 1 146 ASP n 1 147 SER n 1 148 GLY n 1 149 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Staphylococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL-21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTSN2cc _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUC_STAAU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ ; _struct_ref.pdbx_align_begin 83 _struct_ref.pdbx_db_accession P00644 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JOK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00644 _struct_ref_seq.db_align_beg 83 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1JOK _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 124 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00644 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 206 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 124 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THP 'DNA linking' . "THYMIDINE-3',5'-DIPHOSPHATE" ? 'C10 H16 N2 O11 P2' 402.188 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 E-COSY 2 2 2 HMQC-J 3 3 1 DQF-COSY 4 1 1 '2D NOESY' 5 4 2 '2D NOESY' 6 2 2 '3D 1H-15N NOESY-HMQC' 7 2 2 '3D HMQC-NOESY-HMQC' 8 5 2 '2D 1H-13C HMQC' 9 6 2 HNCO 10 1 1 'and others' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 318 ambient 5.5 '300 nM KCl' ? K 2 318 ambient 5.1 '300 nM KCl' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '3.5-5 mM Nuclease-H124L U-50% 2H; 300 mM KCl; D2O' D2O 2 '3.5-5 mM Nuclease-H124L U-95% 15N; 300 mM KCl; H2O' H2O 3 '3.5-5 mM Nuclease-H124L; 300 mM KCl; D2O' D2O 4 '3.5-5 mM Nuclease-H124L U-50% 2H; 300 mM KCl; H2O' H2O 5 '3.5-5 mM Nuclease-H124L U-98% 13C; 300 mM KCl; H2O' H2O 6 '3.5-5 mM Nuclease-H124L U-98% 13C U-99% 15N; 300 mM KCl; H2O' H20 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AM 500 2 ? Bruker AM 600 # _pdbx_nmr_refine.entry_id 1JOK _pdbx_nmr_refine.method 'Distance, hydrogen bond and torsion angle constraints' _pdbx_nmr_refine.details '2261 constraints were used to calculate the structure. Ca2+ is bound, but coordinates for the calcium are not provided.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1JOK _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1JOK _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal Felix ? processing 'Biosym Technologies Inc' 1 X-PLOR 3.1 'structure solution' Brunger 2 'Insight II' 2.3 'structure solution' 'Biosym Technologies Inc' 3 HBPLUS ? 'structure solution' 'McDonald and Thornton' 4 X-PLOR 3.1 refinement Brunger 5 # _exptl.entry_id 1JOK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1JOK _struct.title ;Averaged structure for Staphylococcal nuclease-H124L in ternary complex with Ca2+ and thymidine-3',5'-bisphosphate ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1JOK _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'ternary complex, beta barrel, alpha helix, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 54 ? ALA A 69 ? TYR A 54 ALA A 69 1 ? 16 HELX_P HELX_P2 2 VAL A 99 ? GLN A 106 ? VAL A 99 GLN A 106 1 ? 8 HELX_P HELX_P3 3 HIS A 121 ? LYS A 136 ? HIS A 121 LYS A 136 1 ? 16 HELX_P HELX_P4 4 LEU A 137 ? SER A 141 ? LEU A 137 SER A 141 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 116 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 116 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 117 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 117 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.47 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 5 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 16 ? ALA A 17 ? LYS A 16 ALA A 17 A 2 THR A 22 ? TYR A 27 ? THR A 22 TYR A 27 A 3 GLN A 30 ? LEU A 36 ? GLN A 30 LEU A 36 A 4 GLY A 88 ? ALA A 94 ? GLY A 88 ALA A 94 A 5 ILE A 72 ? PHE A 76 ? ILE A 72 PHE A 76 A 6 HIS A 8 ? ALA A 12 ? HIS A 8 ALA A 12 B 1 LYS A 16 ? ALA A 17 ? LYS A 16 ALA A 17 B 2 THR A 22 ? TYR A 27 ? THR A 22 TYR A 27 B 3 GLN A 30 ? LEU A 36 ? GLN A 30 LEU A 36 B 4 GLY A 88 ? ALA A 94 ? GLY A 88 ALA A 94 B 5 LYS A 97 ? MET A 98 ? LYS A 97 MET A 98 C 1 VAL A 39 ? ASP A 40 ? VAL A 39 ASP A 40 C 2 LYS A 110 ? VAL A 111 ? LYS A 110 VAL A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 16 ? O LYS A 16 N LYS A 24 ? N LYS A 24 A 2 3 N TYR A 27 ? N TYR A 27 O GLN A 30 ? O GLN A 30 A 3 4 O THR A 33 ? O THR A 33 N GLY A 88 ? N GLY A 88 A 4 5 N TYR A 93 ? N TYR A 93 O GLU A 73 ? O GLU A 73 A 5 6 O PHE A 76 ? O PHE A 76 N HIS A 8 ? N HIS A 8 B 1 2 O LYS A 16 ? O LYS A 16 N LYS A 24 ? N LYS A 24 B 2 3 N TYR A 27 ? N TYR A 27 O GLN A 30 ? O GLN A 30 B 3 4 O THR A 33 ? O THR A 33 N GLY A 88 ? N GLY A 88 B 4 5 N ALA A 94 ? N ALA A 94 O LYS A 97 ? O LYS A 97 C 1 2 O ASP A 40 ? O ASP A 40 N LYS A 110 ? N LYS A 110 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id THP _struct_site.pdbx_auth_seq_id 150 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE THP A 150' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 ARG A 35 ? ARG A 35 . ? 1_555 ? 2 AC1 8 LEU A 37 ? LEU A 37 . ? 1_555 ? 3 AC1 8 ASP A 83 ? ASP A 83 . ? 1_555 ? 4 AC1 8 LYS A 84 ? LYS A 84 . ? 1_555 ? 5 AC1 8 TYR A 85 ? TYR A 85 . ? 1_555 ? 6 AC1 8 ARG A 87 ? ARG A 87 . ? 1_555 ? 7 AC1 8 TYR A 113 ? TYR A 113 . ? 1_555 ? 8 AC1 8 TYR A 115 ? TYR A 115 . ? 1_555 ? # _database_PDB_matrix.entry_id 1JOK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JOK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 TRP 140 140 140 TRP TRP A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLN 149 149 149 GLN GLN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id THP _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 150 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id THP _pdbx_nonpoly_scheme.auth_mon_id PDT _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-08-22 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 5 ? ? -133.46 -76.89 2 1 LYS A 6 ? ? -105.01 -96.37 3 1 ILE A 15 ? ? -123.91 -61.10 4 1 LEU A 25 ? ? -119.12 -158.03 5 1 GLU A 43 ? ? 55.58 93.44 6 1 HIS A 46 ? ? 42.59 73.80 7 1 LYS A 48 ? ? -163.72 -82.60 8 1 LYS A 53 ? ? -125.53 -80.60 9 1 GLU A 57 ? ? -160.96 -56.91 10 1 LYS A 63 ? ? -60.47 -70.64 11 1 MET A 65 ? ? -53.08 -78.26 12 1 ASN A 119 ? ? -165.31 27.69 13 1 ASN A 138 ? ? 69.05 -106.73 14 1 TRP A 140 ? ? -85.23 46.70 15 1 SER A 141 ? ? -106.52 -81.91 16 1 ASP A 143 ? ? -164.81 70.48 17 1 ASN A 144 ? ? 177.01 165.34 18 1 ALA A 145 ? ? -118.44 76.94 19 1 SER A 147 ? ? 56.98 71.47 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 35 ? ? 0.305 'SIDE CHAIN' 2 1 ARG A 81 ? ? 0.251 'SIDE CHAIN' 3 1 ARG A 87 ? ? 0.224 'SIDE CHAIN' 4 1 ARG A 105 ? ? 0.261 'SIDE CHAIN' 5 1 ARG A 126 ? ? 0.241 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "THYMIDINE-3',5'-DIPHOSPHATE" _pdbx_entity_nonpoly.comp_id THP #