data_1JPX # _entry.id 1JPX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.283 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1JPX RCSB RCSB014049 WWPDB D_1000014049 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1QBZ . unspecified PDB 1JQ0 '1JQ0 is the mutant version of this entry.' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JPX _pdbx_database_status.recvd_initial_deposition_date 2001-08-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, J.' 1 'Wang, S.' 2 'LaBranche, C.C.' 3 'Hoxie, J.A.' 4 'Lu, M.' 5 # _citation.id primary _citation.title ;Mutations that destabilize the gp41 core are determinants for stabilizing the simian immunodeficiency virus-CPmac envelope glycoprotein complex. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 277 _citation.page_first 12891 _citation.page_last 12900 _citation.year 2002 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11830586 _citation.pdbx_database_id_DOI 10.1074/jbc.M110315200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Liu, J.' 1 primary 'Wang, S.' 2 primary 'Hoxie, J.A.' 3 primary 'LaBranche, C.C.' 4 primary 'Lu, M.' 5 # _cell.entry_id 1JPX _cell.length_a 54.993 _cell.length_b 54.993 _cell.length_c 131.140 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1JPX _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'gp41 envelope protein' 9863.165 3 ? ? 'N40(L6)C38' ? 2 water nat water 18.015 65 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'envelope glycoprotein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTSGGRGGWQEWERKVDFLEENITALLEEAQIQQEKNMYELQ KLNS ; _entity_poly.pdbx_seq_one_letter_code_can ;RTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTSGGRGGWQEWERKVDFLEENITALLEEAQIQQEKNMYELQ KLNS ; _entity_poly.pdbx_strand_id A,D,G _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 THR n 1 3 LEU n 1 4 LEU n 1 5 ALA n 1 6 GLY n 1 7 ILE n 1 8 VAL n 1 9 GLN n 1 10 GLN n 1 11 GLN n 1 12 GLN n 1 13 GLN n 1 14 LEU n 1 15 LEU n 1 16 ASP n 1 17 VAL n 1 18 VAL n 1 19 LYS n 1 20 ARG n 1 21 GLN n 1 22 GLN n 1 23 GLU n 1 24 LEU n 1 25 LEU n 1 26 ARG n 1 27 LEU n 1 28 THR n 1 29 VAL n 1 30 TRP n 1 31 GLY n 1 32 THR n 1 33 LYS n 1 34 ASN n 1 35 LEU n 1 36 GLN n 1 37 THR n 1 38 ARG n 1 39 VAL n 1 40 THR n 1 41 SER n 1 42 GLY n 1 43 GLY n 1 44 ARG n 1 45 GLY n 1 46 GLY n 1 47 TRP n 1 48 GLN n 1 49 GLU n 1 50 TRP n 1 51 GLU n 1 52 ARG n 1 53 LYS n 1 54 VAL n 1 55 ASP n 1 56 PHE n 1 57 LEU n 1 58 GLU n 1 59 GLU n 1 60 ASN n 1 61 ILE n 1 62 THR n 1 63 ALA n 1 64 LEU n 1 65 LEU n 1 66 GLU n 1 67 GLU n 1 68 ALA n 1 69 GLN n 1 70 ILE n 1 71 GLN n 1 72 GLN n 1 73 GLU n 1 74 LYS n 1 75 ASN n 1 76 MET n 1 77 TYR n 1 78 GLU n 1 79 LEU n 1 80 GLN n 1 81 LYS n 1 82 LEU n 1 83 ASN n 1 84 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 1 40 ? Lentivirus ? ? mac251 ? ? ? ? 'Simian immunodeficiency virus' 11723 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 1 2 sample ? 47 84 ? Lentivirus ? ? mac251 ? ? ? ? 'Simian immunodeficiency virus' 11723 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 Escherichia ? ? 'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? # _struct_ref.id 1 _struct_ref.db_code Q87972_SIVCZ _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q87972 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1JPX A 1 ? 40 ? Q87972 555 ? 594 ? 1 40 2 1 1JPX A 47 ? 84 ? Q87972 637 ? 674 ? 47 84 3 1 1JPX D 1 ? 40 ? Q87972 555 ? 594 ? 1 40 4 1 1JPX D 47 ? 84 ? Q87972 637 ? 674 ? 47 84 5 1 1JPX G 1 ? 40 ? Q87972 555 ? 594 ? 1 40 6 1 1JPX G 47 ? 84 ? Q87972 637 ? 674 ? 47 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1JPX SER A 41 ? UNP Q87972 ? ? LINKER 41 1 1 1JPX GLY A 42 ? UNP Q87972 ? ? LINKER 42 2 1 1JPX GLY A 43 ? UNP Q87972 ? ? LINKER 43 3 1 1JPX ARG A 44 ? UNP Q87972 ? ? LINKER 44 4 1 1JPX GLY A 45 ? UNP Q87972 ? ? LINKER 45 5 1 1JPX GLY A 46 ? UNP Q87972 ? ? LINKER 46 6 3 1JPX SER D 41 ? UNP Q87972 ? ? LINKER 41 7 3 1JPX GLY D 42 ? UNP Q87972 ? ? LINKER 42 8 3 1JPX GLY D 43 ? UNP Q87972 ? ? LINKER 43 9 3 1JPX ARG D 44 ? UNP Q87972 ? ? LINKER 44 10 3 1JPX GLY D 45 ? UNP Q87972 ? ? LINKER 45 11 3 1JPX GLY D 46 ? UNP Q87972 ? ? LINKER 46 12 5 1JPX SER G 41 ? UNP Q87972 ? ? LINKER 41 13 5 1JPX GLY G 42 ? UNP Q87972 ? ? LINKER 42 14 5 1JPX GLY G 43 ? UNP Q87972 ? ? LINKER 43 15 5 1JPX ARG G 44 ? UNP Q87972 ? ? LINKER 44 16 5 1JPX GLY G 45 ? UNP Q87972 ? ? LINKER 45 17 5 1JPX GLY G 46 ? UNP Q87972 ? ? LINKER 46 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1JPX _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.93 _exptl_crystal.density_percent_sol 36.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details 'Sodium chloride, CTAB, barium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2001-04-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9480 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE F1' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline F1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9480 # _reflns.entry_id 1JPX _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.3 _reflns.number_obs 9729 _reflns.number_all 9729 _reflns.percent_possible_obs 97.2 _reflns.pdbx_Rmerge_I_obs 0.0570000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.7 _reflns.B_iso_Wilson_estimate 26.8 _reflns.pdbx_redundancy 6.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_all 94.0 _reflns_shell.Rmerge_I_obs 0.2090000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 8.1 _reflns_shell.pdbx_redundancy 6.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1003 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1JPX _refine.ls_number_reflns_obs 9729 _refine.ls_number_reflns_all 9729 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 469445.28 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.ls_d_res_low 44.77 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 97.2 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2370000 _refine.ls_R_factor_R_free 0.2830000 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.5 _refine.ls_number_reflns_R_free 926 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 40.3 _refine.aniso_B[1][1] 14.977 _refine.aniso_B[2][2] 14.977 _refine.aniso_B[3][3] -29.954 _refine.aniso_B[1][2] 7.717 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.354022 _refine.solvent_model_param_bsol 112.528 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1QBZ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1JPX _refine_analyze.Luzzati_coordinate_error_obs 0.18 _refine_analyze.Luzzati_sigma_a_obs 0.33 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.20 _refine_analyze.Luzzati_sigma_a_free 0.40 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1404 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 1469 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 44.77 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.1 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 17.7 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.51 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.28 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.29 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 1.74 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 2.96 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.40 _refine_ls_shell.number_reflns_R_work 1020 _refine_ls_shell.R_factor_R_work 0.3010000 _refine_ls_shell.percent_reflns_obs 94.2 _refine_ls_shell.R_factor_R_free 0.3570000 _refine_ls_shell.R_factor_R_free_error 0.032 _refine_ls_shell.percent_reflns_R_free 12.6 _refine_ls_shell.number_reflns_R_free 147 _refine_ls_shell.number_reflns_obs 1167 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1JPX _struct.title 'Mutation that destabilize the gp41 core: determinants for stabilizing the SIV/CPmac envelope glycoprotein complex. Wild type.' _struct.pdbx_descriptor 'gp41 envelope protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JPX _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'GP41, SIV, HIV-1, MEMBRANE FUSION, SIX-HELIX BUNDLE, TRIMER-of-HAIRPINS, Viral protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # loop_ _struct_biol.id _struct_biol.details _struct_biol.pdbx_parent_biol_id 1 'The biological assembly is a trimer generated from each of the three monomers by the three fold axis.' ? 2 ? ? 3 ? ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 6 ? LYS A 33 ? GLY A 6 LYS A 33 1 ? 28 HELX_P HELX_P2 2 GLU A 49 ? MET A 76 ? GLU A 49 MET A 76 1 ? 28 HELX_P HELX_P3 3 GLY B 6 ? LYS B 33 ? GLY D 6 LYS D 33 1 ? 28 HELX_P HELX_P4 4 GLU B 49 ? MET B 76 ? GLU D 49 MET D 76 1 ? 28 HELX_P HELX_P5 5 GLY C 6 ? LYS C 33 ? GLY G 6 LYS G 33 1 ? 28 HELX_P HELX_P6 6 GLU C 49 ? ASN C 75 ? GLU G 49 ASN G 75 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1JPX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JPX _atom_sites.fract_transf_matrix[1][1] 0.018184 _atom_sites.fract_transf_matrix[1][2] 0.010499 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020997 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007625 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 ? ? ? A . n A 1 35 LEU 35 35 ? ? ? A . n A 1 36 GLN 36 36 ? ? ? A . n A 1 37 THR 37 37 ? ? ? A . n A 1 38 ARG 38 38 ? ? ? A . n A 1 39 VAL 39 39 ? ? ? A . n A 1 40 THR 40 40 ? ? ? A . n A 1 41 SER 41 41 ? ? ? A . n A 1 42 GLY 42 42 ? ? ? A . n A 1 43 GLY 43 43 ? ? ? A . n A 1 44 ARG 44 44 ? ? ? A . n A 1 45 GLY 45 45 ? ? ? A . n A 1 46 GLY 46 46 ? ? ? A . n A 1 47 TRP 47 47 ? ? ? A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 ? ? ? A . n A 1 80 GLN 80 80 ? ? ? A . n A 1 81 LYS 81 81 ? ? ? A . n A 1 82 LEU 82 82 ? ? ? A . n A 1 83 ASN 83 83 ? ? ? A . n A 1 84 SER 84 84 ? ? ? A . n B 1 1 ARG 1 1 ? ? ? D . n B 1 2 THR 2 2 ? ? ? D . n B 1 3 LEU 3 3 ? ? ? D . n B 1 4 LEU 4 4 ? ? ? D . n B 1 5 ALA 5 5 ? ? ? D . n B 1 6 GLY 6 6 6 GLY GLY D . n B 1 7 ILE 7 7 7 ILE ILE D . n B 1 8 VAL 8 8 8 VAL VAL D . n B 1 9 GLN 9 9 9 GLN GLN D . n B 1 10 GLN 10 10 10 GLN GLN D . n B 1 11 GLN 11 11 11 GLN GLN D . n B 1 12 GLN 12 12 12 GLN GLN D . n B 1 13 GLN 13 13 13 GLN GLN D . n B 1 14 LEU 14 14 14 LEU LEU D . n B 1 15 LEU 15 15 15 LEU LEU D . n B 1 16 ASP 16 16 16 ASP ASP D . n B 1 17 VAL 17 17 17 VAL VAL D . n B 1 18 VAL 18 18 18 VAL VAL D . n B 1 19 LYS 19 19 19 LYS LYS D . n B 1 20 ARG 20 20 20 ARG ARG D . n B 1 21 GLN 21 21 21 GLN GLN D . n B 1 22 GLN 22 22 22 GLN GLN D . n B 1 23 GLU 23 23 23 GLU GLU D . n B 1 24 LEU 24 24 24 LEU LEU D . n B 1 25 LEU 25 25 25 LEU LEU D . n B 1 26 ARG 26 26 26 ARG ARG D . n B 1 27 LEU 27 27 27 LEU LEU D . n B 1 28 THR 28 28 28 THR THR D . n B 1 29 VAL 29 29 29 VAL VAL D . n B 1 30 TRP 30 30 30 TRP TRP D . n B 1 31 GLY 31 31 31 GLY GLY D . n B 1 32 THR 32 32 32 THR THR D . n B 1 33 LYS 33 33 33 LYS LYS D . n B 1 34 ASN 34 34 ? ? ? D . n B 1 35 LEU 35 35 ? ? ? D . n B 1 36 GLN 36 36 ? ? ? D . n B 1 37 THR 37 37 ? ? ? D . n B 1 38 ARG 38 38 ? ? ? D . n B 1 39 VAL 39 39 ? ? ? D . n B 1 40 THR 40 40 ? ? ? D . n B 1 41 SER 41 41 ? ? ? D . n B 1 42 GLY 42 42 ? ? ? D . n B 1 43 GLY 43 43 ? ? ? D . n B 1 44 ARG 44 44 ? ? ? D . n B 1 45 GLY 45 45 ? ? ? D . n B 1 46 GLY 46 46 ? ? ? D . n B 1 47 TRP 47 47 ? ? ? D . n B 1 48 GLN 48 48 ? ? ? D . n B 1 49 GLU 49 49 49 GLU GLU D . n B 1 50 TRP 50 50 50 TRP TRP D . n B 1 51 GLU 51 51 51 GLU GLU D . n B 1 52 ARG 52 52 52 ARG ARG D . n B 1 53 LYS 53 53 53 LYS LYS D . n B 1 54 VAL 54 54 54 VAL VAL D . n B 1 55 ASP 55 55 55 ASP ASP D . n B 1 56 PHE 56 56 56 PHE PHE D . n B 1 57 LEU 57 57 57 LEU LEU D . n B 1 58 GLU 58 58 58 GLU GLU D . n B 1 59 GLU 59 59 59 GLU GLU D . n B 1 60 ASN 60 60 60 ASN ASN D . n B 1 61 ILE 61 61 61 ILE ILE D . n B 1 62 THR 62 62 62 THR THR D . n B 1 63 ALA 63 63 63 ALA ALA D . n B 1 64 LEU 64 64 64 LEU LEU D . n B 1 65 LEU 65 65 65 LEU LEU D . n B 1 66 GLU 66 66 66 GLU GLU D . n B 1 67 GLU 67 67 67 GLU GLU D . n B 1 68 ALA 68 68 68 ALA ALA D . n B 1 69 GLN 69 69 69 GLN GLN D . n B 1 70 ILE 70 70 70 ILE ILE D . n B 1 71 GLN 71 71 71 GLN GLN D . n B 1 72 GLN 72 72 72 GLN GLN D . n B 1 73 GLU 73 73 73 GLU GLU D . n B 1 74 LYS 74 74 74 LYS LYS D . n B 1 75 ASN 75 75 75 ASN ASN D . n B 1 76 MET 76 76 76 MET MET D . n B 1 77 TYR 77 77 77 TYR TYR D . n B 1 78 GLU 78 78 ? ? ? D . n B 1 79 LEU 79 79 ? ? ? D . n B 1 80 GLN 80 80 ? ? ? D . n B 1 81 LYS 81 81 ? ? ? D . n B 1 82 LEU 82 82 ? ? ? D . n B 1 83 ASN 83 83 ? ? ? D . n B 1 84 SER 84 84 ? ? ? D . n C 1 1 ARG 1 1 ? ? ? G . n C 1 2 THR 2 2 ? ? ? G . n C 1 3 LEU 3 3 ? ? ? G . n C 1 4 LEU 4 4 ? ? ? G . n C 1 5 ALA 5 5 ? ? ? G . n C 1 6 GLY 6 6 6 GLY GLY G . n C 1 7 ILE 7 7 7 ILE ILE G . n C 1 8 VAL 8 8 8 VAL VAL G . n C 1 9 GLN 9 9 9 GLN GLN G . n C 1 10 GLN 10 10 10 GLN GLN G . n C 1 11 GLN 11 11 11 GLN GLN G . n C 1 12 GLN 12 12 12 GLN GLN G . n C 1 13 GLN 13 13 13 GLN GLN G . n C 1 14 LEU 14 14 14 LEU LEU G . n C 1 15 LEU 15 15 15 LEU LEU G . n C 1 16 ASP 16 16 16 ASP ASP G . n C 1 17 VAL 17 17 17 VAL VAL G . n C 1 18 VAL 18 18 18 VAL VAL G . n C 1 19 LYS 19 19 19 LYS LYS G . n C 1 20 ARG 20 20 20 ARG ARG G . n C 1 21 GLN 21 21 21 GLN GLN G . n C 1 22 GLN 22 22 22 GLN GLN G . n C 1 23 GLU 23 23 23 GLU GLU G . n C 1 24 LEU 24 24 24 LEU LEU G . n C 1 25 LEU 25 25 25 LEU LEU G . n C 1 26 ARG 26 26 26 ARG ARG G . n C 1 27 LEU 27 27 27 LEU LEU G . n C 1 28 THR 28 28 28 THR THR G . n C 1 29 VAL 29 29 29 VAL VAL G . n C 1 30 TRP 30 30 30 TRP TRP G . n C 1 31 GLY 31 31 31 GLY GLY G . n C 1 32 THR 32 32 32 THR THR G . n C 1 33 LYS 33 33 33 LYS LYS G . n C 1 34 ASN 34 34 ? ? ? G . n C 1 35 LEU 35 35 ? ? ? G . n C 1 36 GLN 36 36 ? ? ? G . n C 1 37 THR 37 37 ? ? ? G . n C 1 38 ARG 38 38 ? ? ? G . n C 1 39 VAL 39 39 ? ? ? G . n C 1 40 THR 40 40 ? ? ? G . n C 1 41 SER 41 41 ? ? ? G . n C 1 42 GLY 42 42 ? ? ? G . n C 1 43 GLY 43 43 ? ? ? G . n C 1 44 ARG 44 44 ? ? ? G . n C 1 45 GLY 45 45 ? ? ? G . n C 1 46 GLY 46 46 ? ? ? G . n C 1 47 TRP 47 47 ? ? ? G . n C 1 48 GLN 48 48 48 GLN GLN G . n C 1 49 GLU 49 49 49 GLU GLU G . n C 1 50 TRP 50 50 50 TRP TRP G . n C 1 51 GLU 51 51 51 GLU GLU G . n C 1 52 ARG 52 52 52 ARG ARG G . n C 1 53 LYS 53 53 53 LYS LYS G . n C 1 54 VAL 54 54 54 VAL VAL G . n C 1 55 ASP 55 55 55 ASP ASP G . n C 1 56 PHE 56 56 56 PHE PHE G . n C 1 57 LEU 57 57 57 LEU LEU G . n C 1 58 GLU 58 58 58 GLU GLU G . n C 1 59 GLU 59 59 59 GLU GLU G . n C 1 60 ASN 60 60 60 ASN ASN G . n C 1 61 ILE 61 61 61 ILE ILE G . n C 1 62 THR 62 62 62 THR THR G . n C 1 63 ALA 63 63 63 ALA ALA G . n C 1 64 LEU 64 64 64 LEU LEU G . n C 1 65 LEU 65 65 65 LEU LEU G . n C 1 66 GLU 66 66 66 GLU GLU G . n C 1 67 GLU 67 67 67 GLU GLU G . n C 1 68 ALA 68 68 68 ALA ALA G . n C 1 69 GLN 69 69 69 GLN GLN G . n C 1 70 ILE 70 70 70 ILE ILE G . n C 1 71 GLN 71 71 71 GLN GLN G . n C 1 72 GLN 72 72 72 GLN GLN G . n C 1 73 GLU 73 73 73 GLU GLU G . n C 1 74 LYS 74 74 74 LYS LYS G . n C 1 75 ASN 75 75 75 ASN ASN G . n C 1 76 MET 76 76 ? ? ? G . n C 1 77 TYR 77 77 ? ? ? G . n C 1 78 GLU 78 78 ? ? ? G . n C 1 79 LEU 79 79 ? ? ? G . n C 1 80 GLN 80 80 ? ? ? G . n C 1 81 LYS 81 81 ? ? ? G . n C 1 82 LEU 82 82 ? ? ? G . n C 1 83 ASN 83 83 ? ? ? G . n C 1 84 SER 84 84 ? ? ? G . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 110 110 HOH HOH A . D 2 HOH 2 112 112 HOH HOH A . D 2 HOH 3 113 113 HOH HOH A . D 2 HOH 4 114 114 HOH HOH A . D 2 HOH 5 116 116 HOH HOH A . D 2 HOH 6 117 117 HOH HOH A . D 2 HOH 7 118 118 HOH HOH A . D 2 HOH 8 119 119 HOH HOH A . D 2 HOH 9 120 120 HOH HOH A . D 2 HOH 10 121 121 HOH HOH A . D 2 HOH 11 122 122 HOH HOH A . D 2 HOH 12 123 123 HOH HOH A . D 2 HOH 13 124 124 HOH HOH A . D 2 HOH 14 125 125 HOH HOH A . D 2 HOH 15 126 126 HOH HOH A . D 2 HOH 16 127 127 HOH HOH A . D 2 HOH 17 128 128 HOH HOH A . D 2 HOH 18 129 129 HOH HOH A . D 2 HOH 19 130 130 HOH HOH A . D 2 HOH 20 131 131 HOH HOH A . D 2 HOH 21 132 132 HOH HOH A . D 2 HOH 22 136 136 HOH HOH A . D 2 HOH 23 139 139 HOH HOH A . D 2 HOH 24 140 140 HOH HOH A . D 2 HOH 25 141 141 HOH HOH A . D 2 HOH 26 142 142 HOH HOH A . D 2 HOH 27 143 143 HOH HOH A . D 2 HOH 28 144 144 HOH HOH A . D 2 HOH 29 145 145 HOH HOH A . D 2 HOH 30 146 146 HOH HOH A . D 2 HOH 31 147 147 HOH HOH A . D 2 HOH 32 148 148 HOH HOH A . D 2 HOH 33 160 160 HOH HOH A . D 2 HOH 34 161 161 HOH HOH A . D 2 HOH 35 162 162 HOH HOH A . E 2 HOH 1 102 102 HOH HOH D . E 2 HOH 2 104 104 HOH HOH D . E 2 HOH 3 106 106 HOH HOH D . E 2 HOH 4 107 107 HOH HOH D . E 2 HOH 5 133 133 HOH HOH D . E 2 HOH 6 134 134 HOH HOH D . E 2 HOH 7 137 137 HOH HOH D . E 2 HOH 8 138 138 HOH HOH D . E 2 HOH 9 149 149 HOH HOH D . E 2 HOH 10 150 150 HOH HOH D . E 2 HOH 11 151 151 HOH HOH D . E 2 HOH 12 152 152 HOH HOH D . E 2 HOH 13 154 154 HOH HOH D . E 2 HOH 14 163 163 HOH HOH D . E 2 HOH 15 164 164 HOH HOH D . E 2 HOH 16 165 165 HOH HOH D . F 2 HOH 1 101 101 HOH HOH G . F 2 HOH 2 103 103 HOH HOH G . F 2 HOH 3 105 105 HOH HOH G . F 2 HOH 4 108 108 HOH HOH G . F 2 HOH 5 109 109 HOH HOH G . F 2 HOH 6 111 111 HOH HOH G . F 2 HOH 7 115 115 HOH HOH G . F 2 HOH 8 135 135 HOH HOH G . F 2 HOH 9 153 153 HOH HOH G . F 2 HOH 10 155 155 HOH HOH G . F 2 HOH 11 156 156 HOH HOH G . F 2 HOH 12 157 157 HOH HOH G . F 2 HOH 13 158 158 HOH HOH G . F 2 HOH 14 159 159 HOH HOH G . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 software_defined_assembly PISA trimeric 3 2 software_defined_assembly PISA trimeric 3 3 software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,3 A,D 2 1,4,5 B,E 3 1,6,7 C,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5720 ? 1 MORE -51 ? 1 'SSA (A^2)' 9420 ? 2 'ABSA (A^2)' 5660 ? 2 MORE -51 ? 2 'SSA (A^2)' 9020 ? 3 'ABSA (A^2)' 5640 ? 3 MORE -51 ? 3 'SSA (A^2)' 8360 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_765 -y+2,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 82.4895000000 0.8660254038 -0.5000000000 0.0000000000 47.6253350303 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_675 -x+y+1,-x+2,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 95.2506700606 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 54.9930000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 27.4965000000 -0.8660254038 -0.5000000000 0.0000000000 47.6253350303 0.0000000000 0.0000000000 1.0000000000 0.0000000000 6 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 27.4965000000 0.8660254038 -0.5000000000 0.0000000000 47.6253350303 0.0000000000 0.0000000000 1.0000000000 0.0000000000 7 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -27.4965000000 -0.8660254038 -0.5000000000 0.0000000000 47.6253350303 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-04-24 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' software # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 CNS refinement 1.0 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 33 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 160 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 33 ? CG ? A LYS 33 CG 2 1 Y 1 A LYS 33 ? CD ? A LYS 33 CD 3 1 Y 1 A LYS 33 ? CE ? A LYS 33 CE 4 1 Y 1 A LYS 33 ? NZ ? A LYS 33 NZ 5 1 Y 1 A GLU 51 ? CB ? A GLU 51 CB 6 1 Y 1 A GLU 51 ? CG ? A GLU 51 CG 7 1 Y 1 A GLU 51 ? CD ? A GLU 51 CD 8 1 Y 1 A GLU 51 ? OE1 ? A GLU 51 OE1 9 1 Y 1 A GLU 51 ? OE2 ? A GLU 51 OE2 10 1 Y 1 A ASN 60 ? CG ? A ASN 60 CG 11 1 Y 1 A ASN 60 ? OD1 ? A ASN 60 OD1 12 1 Y 1 A ASN 60 ? ND2 ? A ASN 60 ND2 13 1 Y 1 A GLU 73 ? CG ? A GLU 73 CG 14 1 Y 1 A GLU 73 ? CD ? A GLU 73 CD 15 1 Y 1 A GLU 73 ? OE1 ? A GLU 73 OE1 16 1 Y 1 A GLU 73 ? OE2 ? A GLU 73 OE2 17 1 Y 1 A LYS 74 ? CG ? A LYS 74 CG 18 1 Y 1 A LYS 74 ? CD ? A LYS 74 CD 19 1 Y 1 A LYS 74 ? CE ? A LYS 74 CE 20 1 Y 1 A LYS 74 ? NZ ? A LYS 74 NZ 21 1 Y 1 A MET 76 ? CG ? A MET 76 CG 22 1 Y 1 A MET 76 ? SD ? A MET 76 SD 23 1 Y 1 A MET 76 ? CE ? A MET 76 CE 24 1 Y 1 D LYS 33 ? CG ? B LYS 33 CG 25 1 Y 1 D LYS 33 ? CD ? B LYS 33 CD 26 1 Y 1 D LYS 33 ? CE ? B LYS 33 CE 27 1 Y 1 D LYS 33 ? NZ ? B LYS 33 NZ 28 1 Y 1 D GLU 51 ? CB ? B GLU 51 CB 29 1 Y 1 D GLU 51 ? CG ? B GLU 51 CG 30 1 Y 1 D GLU 51 ? CD ? B GLU 51 CD 31 1 Y 1 D GLU 51 ? OE1 ? B GLU 51 OE1 32 1 Y 1 D GLU 51 ? OE2 ? B GLU 51 OE2 33 1 Y 1 D ASN 60 ? CG ? B ASN 60 CG 34 1 Y 1 D ASN 60 ? OD1 ? B ASN 60 OD1 35 1 Y 1 D ASN 60 ? ND2 ? B ASN 60 ND2 36 1 Y 1 G LYS 33 ? CG ? C LYS 33 CG 37 1 Y 1 G LYS 33 ? CD ? C LYS 33 CD 38 1 Y 1 G LYS 33 ? CE ? C LYS 33 CE 39 1 Y 1 G LYS 33 ? NZ ? C LYS 33 NZ 40 1 Y 1 G GLU 51 ? CB ? C GLU 51 CB 41 1 Y 1 G GLU 51 ? CG ? C GLU 51 CG 42 1 Y 1 G GLU 51 ? CD ? C GLU 51 CD 43 1 Y 1 G GLU 51 ? OE1 ? C GLU 51 OE1 44 1 Y 1 G GLU 51 ? OE2 ? C GLU 51 OE2 45 1 Y 1 G ASN 60 ? CG ? C ASN 60 CG 46 1 Y 1 G ASN 60 ? OD1 ? C ASN 60 OD1 47 1 Y 1 G ASN 60 ? ND2 ? C ASN 60 ND2 48 1 Y 1 G GLU 73 ? CG ? C GLU 73 CG 49 1 Y 1 G GLU 73 ? CD ? C GLU 73 CD 50 1 Y 1 G GLU 73 ? OE1 ? C GLU 73 OE1 51 1 Y 1 G GLU 73 ? OE2 ? C GLU 73 OE2 52 1 Y 1 G LYS 74 ? CG ? C LYS 74 CG 53 1 Y 1 G LYS 74 ? CD ? C LYS 74 CD 54 1 Y 1 G LYS 74 ? CE ? C LYS 74 CE 55 1 Y 1 G LYS 74 ? NZ ? C LYS 74 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 1 ? A ARG 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ASN 34 ? A ASN 34 7 1 Y 1 A LEU 35 ? A LEU 35 8 1 Y 1 A GLN 36 ? A GLN 36 9 1 Y 1 A THR 37 ? A THR 37 10 1 Y 1 A ARG 38 ? A ARG 38 11 1 Y 1 A VAL 39 ? A VAL 39 12 1 Y 1 A THR 40 ? A THR 40 13 1 Y 1 A SER 41 ? A SER 41 14 1 Y 1 A GLY 42 ? A GLY 42 15 1 Y 1 A GLY 43 ? A GLY 43 16 1 Y 1 A ARG 44 ? A ARG 44 17 1 Y 1 A GLY 45 ? A GLY 45 18 1 Y 1 A GLY 46 ? A GLY 46 19 1 Y 1 A TRP 47 ? A TRP 47 20 1 Y 1 A LEU 79 ? A LEU 79 21 1 Y 1 A GLN 80 ? A GLN 80 22 1 Y 1 A LYS 81 ? A LYS 81 23 1 Y 1 A LEU 82 ? A LEU 82 24 1 Y 1 A ASN 83 ? A ASN 83 25 1 Y 1 A SER 84 ? A SER 84 26 1 Y 1 D ARG 1 ? B ARG 1 27 1 Y 1 D THR 2 ? B THR 2 28 1 Y 1 D LEU 3 ? B LEU 3 29 1 Y 1 D LEU 4 ? B LEU 4 30 1 Y 1 D ALA 5 ? B ALA 5 31 1 Y 1 D ASN 34 ? B ASN 34 32 1 Y 1 D LEU 35 ? B LEU 35 33 1 Y 1 D GLN 36 ? B GLN 36 34 1 Y 1 D THR 37 ? B THR 37 35 1 Y 1 D ARG 38 ? B ARG 38 36 1 Y 1 D VAL 39 ? B VAL 39 37 1 Y 1 D THR 40 ? B THR 40 38 1 Y 1 D SER 41 ? B SER 41 39 1 Y 1 D GLY 42 ? B GLY 42 40 1 Y 1 D GLY 43 ? B GLY 43 41 1 Y 1 D ARG 44 ? B ARG 44 42 1 Y 1 D GLY 45 ? B GLY 45 43 1 Y 1 D GLY 46 ? B GLY 46 44 1 Y 1 D TRP 47 ? B TRP 47 45 1 Y 1 D GLN 48 ? B GLN 48 46 1 Y 1 D GLU 78 ? B GLU 78 47 1 Y 1 D LEU 79 ? B LEU 79 48 1 Y 1 D GLN 80 ? B GLN 80 49 1 Y 1 D LYS 81 ? B LYS 81 50 1 Y 1 D LEU 82 ? B LEU 82 51 1 Y 1 D ASN 83 ? B ASN 83 52 1 Y 1 D SER 84 ? B SER 84 53 1 Y 1 G ARG 1 ? C ARG 1 54 1 Y 1 G THR 2 ? C THR 2 55 1 Y 1 G LEU 3 ? C LEU 3 56 1 Y 1 G LEU 4 ? C LEU 4 57 1 Y 1 G ALA 5 ? C ALA 5 58 1 Y 1 G ASN 34 ? C ASN 34 59 1 Y 1 G LEU 35 ? C LEU 35 60 1 Y 1 G GLN 36 ? C GLN 36 61 1 Y 1 G THR 37 ? C THR 37 62 1 Y 1 G ARG 38 ? C ARG 38 63 1 Y 1 G VAL 39 ? C VAL 39 64 1 Y 1 G THR 40 ? C THR 40 65 1 Y 1 G SER 41 ? C SER 41 66 1 Y 1 G GLY 42 ? C GLY 42 67 1 Y 1 G GLY 43 ? C GLY 43 68 1 Y 1 G ARG 44 ? C ARG 44 69 1 Y 1 G GLY 45 ? C GLY 45 70 1 Y 1 G GLY 46 ? C GLY 46 71 1 Y 1 G TRP 47 ? C TRP 47 72 1 Y 1 G MET 76 ? C MET 76 73 1 Y 1 G TYR 77 ? C TYR 77 74 1 Y 1 G GLU 78 ? C GLU 78 75 1 Y 1 G LEU 79 ? C LEU 79 76 1 Y 1 G GLN 80 ? C GLN 80 77 1 Y 1 G LYS 81 ? C LYS 81 78 1 Y 1 G LEU 82 ? C LEU 82 79 1 Y 1 G ASN 83 ? C ASN 83 80 1 Y 1 G SER 84 ? C SER 84 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #