data_1JQ6 # _entry.id 1JQ6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1JQ6 RCSB RCSB014058 WWPDB D_1000014058 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1WPO 'structure of human cytomegalovirus protease' unspecified PDB 2WPO 'human cytomegalovirus protease complexed to peptidomimetic inhibitor BILC821' unspecified PDB 1JQ7 'human cytomegalovirus protease mutant, S225Y - inhibitor complex' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JQ6 _pdbx_database_status.recvd_initial_deposition_date 2001-08-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Batra, R.' 1 'Khayat, R.' 2 'Tong, L.' 3 # _citation.id primary _citation.title 'Molecular mechanism for dimerization to regulate the catalytic activity of human cytomegalovirus protease.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 8 _citation.page_first 810 _citation.page_last 817 _citation.year 2001 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11524687 _citation.pdbx_database_id_DOI 10.1038/nsb0901-810 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Batra, R.' 1 primary 'Khayat, R.' 2 primary 'Tong, L.' 3 # _cell.entry_id 1JQ6 _cell.length_a 42.270 _cell.length_b 108.300 _cell.length_c 108.500 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1JQ6 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ASSEMBLIN 28518.590 1 3.4.21.97 'A143Q, S225Y' ? ? 2 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PROTEASE # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRD GLFCLG(CAS)VTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEQATSLSGSETTPFK HVAL(CAS)SVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQR(CAS)GSTAVDASGDPFRSDSYGLLGNYVDA LYIRERLPKLRYDKQLVGVTERESYVKA ; _entity_poly.pdbx_seq_one_letter_code_can ;MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRD GLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEQATSLSGSETTPFKHVAL CSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDSYGLLGNYVDALYIRERLPKLRY DKQLVGVTERESYVKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 MET n 1 4 ASP n 1 5 GLU n 1 6 GLN n 1 7 GLN n 1 8 SER n 1 9 GLN n 1 10 ALA n 1 11 VAL n 1 12 ALA n 1 13 PRO n 1 14 VAL n 1 15 TYR n 1 16 VAL n 1 17 GLY n 1 18 GLY n 1 19 PHE n 1 20 LEU n 1 21 ALA n 1 22 ARG n 1 23 TYR n 1 24 ASP n 1 25 GLN n 1 26 SER n 1 27 PRO n 1 28 ASP n 1 29 GLU n 1 30 ALA n 1 31 GLU n 1 32 LEU n 1 33 LEU n 1 34 LEU n 1 35 PRO n 1 36 ARG n 1 37 ASP n 1 38 VAL n 1 39 VAL n 1 40 GLU n 1 41 HIS n 1 42 TRP n 1 43 LEU n 1 44 HIS n 1 45 ALA n 1 46 GLN n 1 47 GLY n 1 48 GLN n 1 49 GLY n 1 50 GLN n 1 51 PRO n 1 52 SER n 1 53 LEU n 1 54 SER n 1 55 VAL n 1 56 ALA n 1 57 LEU n 1 58 PRO n 1 59 LEU n 1 60 ASN n 1 61 ILE n 1 62 ASN n 1 63 HIS n 1 64 ASP n 1 65 ASP n 1 66 THR n 1 67 ALA n 1 68 VAL n 1 69 VAL n 1 70 GLY n 1 71 HIS n 1 72 VAL n 1 73 ALA n 1 74 ALA n 1 75 MET n 1 76 GLN n 1 77 SER n 1 78 VAL n 1 79 ARG n 1 80 ASP n 1 81 GLY n 1 82 LEU n 1 83 PHE n 1 84 CYS n 1 85 LEU n 1 86 GLY n 1 87 CAS n 1 88 VAL n 1 89 THR n 1 90 SER n 1 91 PRO n 1 92 ARG n 1 93 PHE n 1 94 LEU n 1 95 GLU n 1 96 ILE n 1 97 VAL n 1 98 ARG n 1 99 ARG n 1 100 ALA n 1 101 SER n 1 102 GLU n 1 103 LYS n 1 104 SER n 1 105 GLU n 1 106 LEU n 1 107 VAL n 1 108 SER n 1 109 ARG n 1 110 GLY n 1 111 PRO n 1 112 VAL n 1 113 SER n 1 114 PRO n 1 115 LEU n 1 116 GLN n 1 117 PRO n 1 118 ASP n 1 119 LYS n 1 120 VAL n 1 121 VAL n 1 122 GLU n 1 123 PHE n 1 124 LEU n 1 125 SER n 1 126 GLY n 1 127 SER n 1 128 TYR n 1 129 ALA n 1 130 GLY n 1 131 LEU n 1 132 SER n 1 133 LEU n 1 134 SER n 1 135 SER n 1 136 ARG n 1 137 ARG n 1 138 CYS n 1 139 ASP n 1 140 ASP n 1 141 VAL n 1 142 GLU n 1 143 GLN n 1 144 ALA n 1 145 THR n 1 146 SER n 1 147 LEU n 1 148 SER n 1 149 GLY n 1 150 SER n 1 151 GLU n 1 152 THR n 1 153 THR n 1 154 PRO n 1 155 PHE n 1 156 LYS n 1 157 HIS n 1 158 VAL n 1 159 ALA n 1 160 LEU n 1 161 CAS n 1 162 SER n 1 163 VAL n 1 164 GLY n 1 165 ARG n 1 166 ARG n 1 167 ARG n 1 168 GLY n 1 169 THR n 1 170 LEU n 1 171 ALA n 1 172 VAL n 1 173 TYR n 1 174 GLY n 1 175 ARG n 1 176 ASP n 1 177 PRO n 1 178 GLU n 1 179 TRP n 1 180 VAL n 1 181 THR n 1 182 GLN n 1 183 ARG n 1 184 PHE n 1 185 PRO n 1 186 ASP n 1 187 LEU n 1 188 THR n 1 189 ALA n 1 190 ALA n 1 191 ASP n 1 192 ARG n 1 193 ASP n 1 194 GLY n 1 195 LEU n 1 196 ARG n 1 197 ALA n 1 198 GLN n 1 199 TRP n 1 200 GLN n 1 201 ARG n 1 202 CAS n 1 203 GLY n 1 204 SER n 1 205 THR n 1 206 ALA n 1 207 VAL n 1 208 ASP n 1 209 ALA n 1 210 SER n 1 211 GLY n 1 212 ASP n 1 213 PRO n 1 214 PHE n 1 215 ARG n 1 216 SER n 1 217 ASP n 1 218 SER n 1 219 TYR n 1 220 GLY n 1 221 LEU n 1 222 LEU n 1 223 GLY n 1 224 ASN n 1 225 TYR n 1 226 VAL n 1 227 ASP n 1 228 ALA n 1 229 LEU n 1 230 TYR n 1 231 ILE n 1 232 ARG n 1 233 GLU n 1 234 ARG n 1 235 LEU n 1 236 PRO n 1 237 LYS n 1 238 LEU n 1 239 ARG n 1 240 TYR n 1 241 ASP n 1 242 LYS n 1 243 GLN n 1 244 LEU n 1 245 VAL n 1 246 GLY n 1 247 VAL n 1 248 THR n 1 249 GLU n 1 250 ARG n 1 251 GLU n 1 252 SER n 1 253 TYR n 1 254 VAL n 1 255 LYS n 1 256 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Human cytomegalovirus' _entity_src_gen.gene_src_genus Cytomegalovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human herpesvirus 5' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10359 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VP40_HCMVA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRD GLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVAL CSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDSYGLLGNSVDALYIRERLPKLRY DKQLVGVTERESYVKA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P16753 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JQ6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 256 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16753 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 256 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 256 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1JQ6 CAS A 87 ? UNP P16753 CYS 87 'MODIFIED RESIDUE' 87 1 1 1JQ6 GLN A 143 ? UNP P16753 ALA 143 ENGINEERED 143 2 1 1JQ6 CAS A 161 ? UNP P16753 CYS 161 'MODIFIED RESIDUE' 161 3 1 1JQ6 CAS A 202 ? UNP P16753 CYS 202 'MODIFIED RESIDUE' 202 4 1 1JQ6 TYR A 225 ? UNP P16753 SER 225 ENGINEERED 225 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAS 'L-peptide linking' n 'S-(DIMETHYLARSENIC)CYSTEINE' ? 'C5 H12 As N O2 S' 225.141 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1JQ6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_percent_sol 43.47 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_details ;PEG 8000, sodium cacodylate, magnesium acetate, glycerol, spermine tetrahydrochloride, DTT, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 294K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type FUJI _diffrn_detector.pdbx_collection_date 2000-11-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 Channel' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.976 # _reflns.entry_id 1JQ6 _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 19.3 _reflns.d_resolution_high 2.3 _reflns.number_obs 10420 _reflns.number_all 38153 _reflns.percent_possible_obs 91 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 18.5 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.44 _reflns_shell.percent_possible_all 93 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1JQ6 _refine.ls_number_reflns_obs 10420 _refine.ls_number_reflns_all 38153 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 5293688.41 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.ls_d_res_low 19.30 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 91.0 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all 0.2360000 _refine.ls_R_factor_R_work 0.2290000 _refine.ls_R_factor_R_free 0.2860000 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.6 _refine.ls_number_reflns_R_free 793 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 43.2 _refine.aniso_B[1][1] -1.16 _refine.aniso_B[2][2] 14.63 _refine.aniso_B[3][3] -13.47 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.394661 _refine.solvent_model_param_bsol 56.4329 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1WPO (monomer)' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1JQ6 _refine_analyze.Luzzati_coordinate_error_obs 0.28 _refine_analyze.Luzzati_sigma_a_obs 0.22 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.38 _refine_analyze.Luzzati_sigma_a_free 0.29 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1336 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1378 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 19.30 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.8 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.86 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.59 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.73 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.15 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.16 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.44 _refine_ls_shell.number_reflns_R_work 1465 _refine_ls_shell.R_factor_R_work 0.2490000 _refine_ls_shell.percent_reflns_obs 84.4 _refine_ls_shell.R_factor_R_free 0.2840000 _refine_ls_shell.R_factor_R_free_error 0.026 _refine_ls_shell.percent_reflns_R_free 7.5 _refine_ls_shell.number_reflns_R_free 118 _refine_ls_shell.number_reflns_obs 1070 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 PARAM.DAT ? 'X-RAY DIFFRACTION' 3 WATER_REP.PARAM ? 'X-RAY DIFFRACTION' # _struct.entry_id 1JQ6 _struct.title 'HUMAN CYTOMEGALOVIRUS PROTEASE DIMER-INTERFACE MUTANT, S225Y' _struct.pdbx_descriptor 'ASSEMBLIN (E.C.3.4.21.97)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JQ6 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Herpesvirus, cytomegalovirus, serine protease, dimerization, enzyme activity regulation, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'Monomer in the asymmetric unit, but biological assembly unit is a dimer that can be generated by the two fold axis.' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 35 ? GLU A 40 ? PRO A 35 GLU A 40 1 ? 6 HELX_P HELX_P2 2 SER A 90 ? GLU A 102 ? SER A 90 GLU A 102 1 ? 13 HELX_P HELX_P3 3 ASP A 118 ? TYR A 128 ? ASP A 118 TYR A 128 1 ? 11 HELX_P HELX_P4 4 ASP A 176 ? GLN A 182 ? ASP A 176 GLN A 182 1 ? 7 HELX_P HELX_P5 5 THR A 188 ? GLN A 200 ? THR A 188 GLN A 200 1 ? 13 HELX_P HELX_P6 6 ARG A 201 ? THR A 205 ? ARG A 201 THR A 205 5 ? 5 HELX_P HELX_P7 7 ASP A 217 ? TYR A 230 ? ASP A 217 TYR A 230 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLY 86 C ? ? ? 1_555 A CAS 87 N ? ? A GLY 86 A CAS 87 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A CAS 87 C ? ? ? 1_555 A VAL 88 N ? ? A CAS 87 A VAL 88 1_555 ? ? ? ? ? ? ? 1.326 ? covale3 covale ? ? A LEU 160 C ? ? ? 1_555 A CAS 161 N ? ? A LEU 160 A CAS 161 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale ? ? A CAS 161 C ? ? ? 1_555 A SER 162 N ? ? A CAS 161 A SER 162 1_555 ? ? ? ? ? ? ? 1.333 ? covale5 covale ? ? A ARG 201 C ? ? ? 1_555 A CAS 202 N ? ? A ARG 201 A CAS 202 1_555 ? ? ? ? ? ? ? 1.334 ? covale6 covale ? ? A CAS 202 C ? ? ? 1_555 A GLY 203 N ? ? A CAS 202 A GLY 203 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 130 ? LEU A 133 ? GLY A 130 LEU A 133 A 2 VAL A 158 ? CAS A 161 ? VAL A 158 CAS A 161 A 3 PRO A 58 ? ILE A 61 ? PRO A 58 ILE A 61 A 4 ASP A 64 ? SER A 77 ? ASP A 64 SER A 77 A 5 GLY A 81 ? VAL A 88 ? GLY A 81 VAL A 88 A 6 VAL A 14 ? ARG A 22 ? VAL A 14 ARG A 22 A 7 VAL A 172 ? GLY A 174 ? VAL A 172 GLY A 174 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 130 ? N GLY A 130 O CAS A 161 ? O CAS A 161 A 2 3 O LEU A 160 ? O LEU A 160 N ASN A 60 ? N ASN A 60 A 3 4 N LEU A 59 ? N LEU A 59 O GLY A 70 ? O GLY A 70 A 4 5 N GLN A 76 ? N GLN A 76 O PHE A 83 ? O PHE A 83 A 5 6 O VAL A 88 ? O VAL A 88 N VAL A 14 ? N VAL A 14 A 6 7 N TYR A 15 ? N TYR A 15 O GLY A 174 ? O GLY A 174 # _database_PDB_matrix.entry_id 1JQ6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JQ6 _atom_sites.fract_transf_matrix[1][1] 0.023657 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009234 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009217 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AS C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 MET 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 GLN 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 GLN 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLN 25 25 ? ? ? A . n A 1 26 SER 26 26 ? ? ? A . n A 1 27 PRO 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 GLU 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 GLU 31 31 ? ? ? A . n A 1 32 LEU 32 32 ? ? ? A . n A 1 33 LEU 33 33 ? ? ? A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LEU 43 43 ? ? ? A . n A 1 44 HIS 44 44 ? ? ? A . n A 1 45 ALA 45 45 ? ? ? A . n A 1 46 GLN 46 46 ? ? ? A . n A 1 47 GLY 47 47 ? ? ? A . n A 1 48 GLN 48 48 ? ? ? A . n A 1 49 GLY 49 49 ? ? ? A . n A 1 50 GLN 50 50 ? ? ? A . n A 1 51 PRO 51 51 ? ? ? A . n A 1 52 SER 52 52 ? ? ? A . n A 1 53 LEU 53 53 ? ? ? A . n A 1 54 SER 54 54 ? ? ? A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 CAS 87 87 87 CAS CAS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 SER 135 135 ? ? ? A . n A 1 136 ARG 136 136 ? ? ? A . n A 1 137 ARG 137 137 ? ? ? A . n A 1 138 CYS 138 138 ? ? ? A . n A 1 139 ASP 139 139 ? ? ? A . n A 1 140 ASP 140 140 ? ? ? A . n A 1 141 VAL 141 141 ? ? ? A . n A 1 142 GLU 142 142 ? ? ? A . n A 1 143 GLN 143 143 ? ? ? A . n A 1 144 ALA 144 144 ? ? ? A . n A 1 145 THR 145 145 ? ? ? A . n A 1 146 SER 146 146 ? ? ? A . n A 1 147 LEU 147 147 ? ? ? A . n A 1 148 SER 148 148 ? ? ? A . n A 1 149 GLY 149 149 ? ? ? A . n A 1 150 SER 150 150 ? ? ? A . n A 1 151 GLU 151 151 ? ? ? A . n A 1 152 THR 152 152 ? ? ? A . n A 1 153 THR 153 153 ? ? ? A . n A 1 154 PRO 154 154 ? ? ? A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 CAS 161 161 161 CAS CAS A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 GLY 164 164 ? ? ? A . n A 1 165 ARG 165 165 ? ? ? A . n A 1 166 ARG 166 166 ? ? ? A . n A 1 167 ARG 167 167 ? ? ? A . n A 1 168 GLY 168 168 ? ? ? A . n A 1 169 THR 169 169 ? ? ? A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 TYR 173 173 173 TYR TYR A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 TRP 199 199 199 TRP TRP A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 CAS 202 202 202 CAS CAS A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 TYR 219 219 219 TYR TYR A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 TYR 225 225 225 TYR TYR A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 ILE 231 231 ? ? ? A . n A 1 232 ARG 232 232 ? ? ? A . n A 1 233 GLU 233 233 ? ? ? A . n A 1 234 ARG 234 234 ? ? ? A . n A 1 235 LEU 235 235 ? ? ? A . n A 1 236 PRO 236 236 ? ? ? A . n A 1 237 LYS 237 237 ? ? ? A . n A 1 238 LEU 238 238 ? ? ? A . n A 1 239 ARG 239 239 ? ? ? A . n A 1 240 TYR 240 240 ? ? ? A . n A 1 241 ASP 241 241 ? ? ? A . n A 1 242 LYS 242 242 ? ? ? A . n A 1 243 GLN 243 243 ? ? ? A . n A 1 244 LEU 244 244 ? ? ? A . n A 1 245 VAL 245 245 ? ? ? A . n A 1 246 GLY 246 246 ? ? ? A . n A 1 247 VAL 247 247 ? ? ? A . n A 1 248 THR 248 248 ? ? ? A . n A 1 249 GLU 249 249 ? ? ? A . n A 1 250 ARG 250 250 ? ? ? A . n A 1 251 GLU 251 251 ? ? ? A . n A 1 252 SER 252 252 ? ? ? A . n A 1 253 TYR 253 253 ? ? ? A . n A 1 254 VAL 254 254 ? ? ? A . n A 1 255 LYS 255 255 ? ? ? A . n A 1 256 ALA 256 256 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CAS 87 A CAS 87 ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' 2 A CAS 161 A CAS 161 ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' 3 A CAS 202 A CAS 202 ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2260 ? 1 MORE -23 ? 1 'SSA (A^2)' 16690 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 42.2700000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 54.2500000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-09-12 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal COMO phasing . ? 1 CNS refinement 1.0 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 21 ? ? -174.35 139.94 2 1 GLU A 40 ? ? 73.15 121.88 3 1 ARG A 109 ? ? -62.99 -169.12 4 1 PRO A 114 ? ? -58.43 -3.07 5 1 LEU A 187 ? ? -39.40 122.57 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A CAS 87 ? CE1 ? A CAS 87 CE1 2 1 Y 1 A CAS 87 ? CE2 ? A CAS 87 CE2 3 1 Y 1 A CAS 161 ? CE1 ? A CAS 161 CE1 4 1 Y 1 A CAS 161 ? CE2 ? A CAS 161 CE2 5 1 Y 1 A CAS 202 ? CE1 ? A CAS 202 CE1 6 1 Y 1 A CAS 202 ? CE2 ? A CAS 202 CE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A MET 3 ? A MET 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A GLN 7 ? A GLN 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A GLN 9 ? A GLN 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A GLN 25 ? A GLN 25 12 1 Y 1 A SER 26 ? A SER 26 13 1 Y 1 A PRO 27 ? A PRO 27 14 1 Y 1 A ASP 28 ? A ASP 28 15 1 Y 1 A GLU 29 ? A GLU 29 16 1 Y 1 A ALA 30 ? A ALA 30 17 1 Y 1 A GLU 31 ? A GLU 31 18 1 Y 1 A LEU 32 ? A LEU 32 19 1 Y 1 A LEU 33 ? A LEU 33 20 1 Y 1 A LEU 43 ? A LEU 43 21 1 Y 1 A HIS 44 ? A HIS 44 22 1 Y 1 A ALA 45 ? A ALA 45 23 1 Y 1 A GLN 46 ? A GLN 46 24 1 Y 1 A GLY 47 ? A GLY 47 25 1 Y 1 A GLN 48 ? A GLN 48 26 1 Y 1 A GLY 49 ? A GLY 49 27 1 Y 1 A GLN 50 ? A GLN 50 28 1 Y 1 A PRO 51 ? A PRO 51 29 1 Y 1 A SER 52 ? A SER 52 30 1 Y 1 A LEU 53 ? A LEU 53 31 1 Y 1 A SER 54 ? A SER 54 32 1 Y 0 A VAL 55 ? A VAL 55 33 1 Y 1 A SER 135 ? A SER 135 34 1 Y 1 A ARG 136 ? A ARG 136 35 1 Y 1 A ARG 137 ? A ARG 137 36 1 Y 1 A CYS 138 ? A CYS 138 37 1 Y 1 A ASP 139 ? A ASP 139 38 1 Y 1 A ASP 140 ? A ASP 140 39 1 Y 1 A VAL 141 ? A VAL 141 40 1 Y 1 A GLU 142 ? A GLU 142 41 1 Y 1 A GLN 143 ? A GLN 143 42 1 Y 1 A ALA 144 ? A ALA 144 43 1 Y 1 A THR 145 ? A THR 145 44 1 Y 1 A SER 146 ? A SER 146 45 1 Y 1 A LEU 147 ? A LEU 147 46 1 Y 1 A SER 148 ? A SER 148 47 1 Y 1 A GLY 149 ? A GLY 149 48 1 Y 1 A SER 150 ? A SER 150 49 1 Y 1 A GLU 151 ? A GLU 151 50 1 Y 1 A THR 152 ? A THR 152 51 1 Y 1 A THR 153 ? A THR 153 52 1 Y 1 A PRO 154 ? A PRO 154 53 1 Y 1 A GLY 164 ? A GLY 164 54 1 Y 1 A ARG 165 ? A ARG 165 55 1 Y 1 A ARG 166 ? A ARG 166 56 1 Y 1 A ARG 167 ? A ARG 167 57 1 Y 1 A GLY 168 ? A GLY 168 58 1 Y 1 A THR 169 ? A THR 169 59 1 Y 1 A ILE 231 ? A ILE 231 60 1 Y 1 A ARG 232 ? A ARG 232 61 1 Y 1 A GLU 233 ? A GLU 233 62 1 Y 1 A ARG 234 ? A ARG 234 63 1 Y 1 A LEU 235 ? A LEU 235 64 1 Y 1 A PRO 236 ? A PRO 236 65 1 Y 1 A LYS 237 ? A LYS 237 66 1 Y 1 A LEU 238 ? A LEU 238 67 1 Y 1 A ARG 239 ? A ARG 239 68 1 Y 1 A TYR 240 ? A TYR 240 69 1 Y 1 A ASP 241 ? A ASP 241 70 1 Y 1 A LYS 242 ? A LYS 242 71 1 Y 1 A GLN 243 ? A GLN 243 72 1 Y 1 A LEU 244 ? A LEU 244 73 1 Y 1 A VAL 245 ? A VAL 245 74 1 Y 1 A GLY 246 ? A GLY 246 75 1 Y 1 A VAL 247 ? A VAL 247 76 1 Y 1 A THR 248 ? A THR 248 77 1 Y 1 A GLU 249 ? A GLU 249 78 1 Y 1 A ARG 250 ? A ARG 250 79 1 Y 1 A GLU 251 ? A GLU 251 80 1 Y 1 A SER 252 ? A SER 252 81 1 Y 1 A TYR 253 ? A TYR 253 82 1 Y 1 A VAL 254 ? A VAL 254 83 1 Y 1 A LYS 255 ? A LYS 255 84 1 Y 1 A ALA 256 ? A ALA 256 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 257 1 HOH TIP A . B 2 HOH 2 258 2 HOH TIP A . B 2 HOH 3 259 3 HOH TIP A . B 2 HOH 4 260 4 HOH TIP A . B 2 HOH 5 261 5 HOH TIP A . B 2 HOH 6 262 6 HOH TIP A . B 2 HOH 7 263 7 HOH TIP A . B 2 HOH 8 264 8 HOH TIP A . B 2 HOH 9 265 9 HOH TIP A . B 2 HOH 10 266 10 HOH TIP A . B 2 HOH 11 267 11 HOH TIP A . B 2 HOH 12 268 12 HOH TIP A . B 2 HOH 13 269 13 HOH TIP A . B 2 HOH 14 270 14 HOH TIP A . B 2 HOH 15 271 15 HOH TIP A . B 2 HOH 16 272 16 HOH TIP A . B 2 HOH 17 273 17 HOH TIP A . B 2 HOH 18 274 18 HOH TIP A . B 2 HOH 19 275 19 HOH TIP A . B 2 HOH 20 276 20 HOH TIP A . B 2 HOH 21 277 21 HOH TIP A . B 2 HOH 22 278 22 HOH TIP A . B 2 HOH 23 279 23 HOH TIP A . B 2 HOH 24 280 24 HOH TIP A . B 2 HOH 25 281 25 HOH TIP A . B 2 HOH 26 282 26 HOH TIP A . B 2 HOH 27 283 27 HOH TIP A . B 2 HOH 28 284 28 HOH TIP A . B 2 HOH 29 285 29 HOH TIP A . B 2 HOH 30 286 30 HOH TIP A . B 2 HOH 31 287 31 HOH TIP A . B 2 HOH 32 288 32 HOH TIP A . B 2 HOH 33 289 33 HOH TIP A . B 2 HOH 34 290 34 HOH TIP A . B 2 HOH 35 291 35 HOH TIP A . B 2 HOH 36 292 36 HOH TIP A . B 2 HOH 37 293 37 HOH TIP A . B 2 HOH 38 294 38 HOH TIP A . B 2 HOH 39 295 39 HOH TIP A . B 2 HOH 40 296 40 HOH TIP A . B 2 HOH 41 297 41 HOH TIP A . B 2 HOH 42 298 42 HOH TIP A . #