data_1JRM # _entry.id 1JRM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JRM pdb_00001jrm 10.2210/pdb1jrm/pdb RCSB RCSB014109 ? ? WWPDB D_1000014109 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id TT135 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JRM _pdbx_database_status.recvd_initial_deposition_date 2001-08-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pineda-Lucena, A.' 1 'Northeast Structural Genomics Consortium (NESG)' 2 # _citation.id primary _citation.title 'An NMR approach to structural proteomics.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 99 _citation.page_first 1825 _citation.page_last 1830 _citation.year 2002 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11854485 _citation.pdbx_database_id_DOI 10.1073/pnas.042684599 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yee, A.' 1 ? primary 'Chang, X.' 2 ? primary 'Pineda-Lucena, A.' 3 ? primary 'Wu, B.' 4 ? primary 'Semesi, A.' 5 ? primary 'Le, B.' 6 ? primary 'Ramelot, T.' 7 ? primary 'Lee, G.M.' 8 ? primary 'Bhattacharyya, S.' 9 ? primary 'Gutierrez, P.' 10 ? primary 'Denisov, A.' 11 ? primary 'Lee, C.H.' 12 ? primary 'Cort, J.R.' 13 ? primary 'Kozlov, G.' 14 ? primary 'Liao, J.' 15 ? primary 'Finak, G.' 16 ? primary 'Chen, L.' 17 ? primary 'Wishart, D.' 18 ? primary 'Lee, W.' 19 ? primary 'McIntosh, L.P.' 20 ? primary 'Gehring, K.' 21 ? primary 'Kennedy, M.A.' 22 ? primary 'Edwards, A.M.' 23 ? primary 'Arrowsmith, C.H.' 24 ? # _cell.entry_id 1JRM _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CONSERVED HYPOTHETICAL PROTEIN mth637' _entity.formula_weight 11848.713 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name MTH0637 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VITMDCLREVGDDLLVNIEVSPASGKFGIPSYNEWRKRIEVKIHSPPQKGKANREIIKEFSETFGRDVEIVSGQKSRQKT IRIQGMGRDLFLKLVSEKFGLEIP ; _entity_poly.pdbx_seq_one_letter_code_can ;VITMDCLREVGDDLLVNIEVSPASGKFGIPSYNEWRKRIEVKIHSPPQKGKANREIIKEFSETFGRDVEIVSGQKSRQKT IRIQGMGRDLFLKLVSEKFGLEIP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier TT135 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ILE n 1 3 THR n 1 4 MET n 1 5 ASP n 1 6 CYS n 1 7 LEU n 1 8 ARG n 1 9 GLU n 1 10 VAL n 1 11 GLY n 1 12 ASP n 1 13 ASP n 1 14 LEU n 1 15 LEU n 1 16 VAL n 1 17 ASN n 1 18 ILE n 1 19 GLU n 1 20 VAL n 1 21 SER n 1 22 PRO n 1 23 ALA n 1 24 SER n 1 25 GLY n 1 26 LYS n 1 27 PHE n 1 28 GLY n 1 29 ILE n 1 30 PRO n 1 31 SER n 1 32 TYR n 1 33 ASN n 1 34 GLU n 1 35 TRP n 1 36 ARG n 1 37 LYS n 1 38 ARG n 1 39 ILE n 1 40 GLU n 1 41 VAL n 1 42 LYS n 1 43 ILE n 1 44 HIS n 1 45 SER n 1 46 PRO n 1 47 PRO n 1 48 GLN n 1 49 LYS n 1 50 GLY n 1 51 LYS n 1 52 ALA n 1 53 ASN n 1 54 ARG n 1 55 GLU n 1 56 ILE n 1 57 ILE n 1 58 LYS n 1 59 GLU n 1 60 PHE n 1 61 SER n 1 62 GLU n 1 63 THR n 1 64 PHE n 1 65 GLY n 1 66 ARG n 1 67 ASP n 1 68 VAL n 1 69 GLU n 1 70 ILE n 1 71 VAL n 1 72 SER n 1 73 GLY n 1 74 GLN n 1 75 LYS n 1 76 SER n 1 77 ARG n 1 78 GLN n 1 79 LYS n 1 80 THR n 1 81 ILE n 1 82 ARG n 1 83 ILE n 1 84 GLN n 1 85 GLY n 1 86 MET n 1 87 GLY n 1 88 ARG n 1 89 ASP n 1 90 LEU n 1 91 PHE n 1 92 LEU n 1 93 LYS n 1 94 LEU n 1 95 VAL n 1 96 SER n 1 97 GLU n 1 98 LYS n 1 99 PHE n 1 100 GLY n 1 101 LEU n 1 102 GLU n 1 103 ILE n 1 104 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Methanothermobacter _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanothermobacter thermautotrophicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 145262 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y637_METTH _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MITMDCLREVGDDLLVNIEVSPASGKFGIPSYNEWRKRIEVKIHSPPQKGKANREIIKEFSETFGRDVEIVSGQKSRQKT IRIQGMGRDLFLKLVSEKFGLEIP ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession O26734 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JRM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O26734 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1JRM _struct_ref_seq_dif.mon_id VAL _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O26734 _struct_ref_seq_dif.db_mon_id MET _struct_ref_seq_dif.pdbx_seq_db_seq_num 1 _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 HNCACB 2 1 1 'CBCA(CO)NH' 3 1 1 CCC-TOCSY-NNH 4 1 1 HCCH-TOCSY 5 1 1 3D_13C-separated_NOESY 6 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 450 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM MTH0637 U-15N,13C; 25mM phosphate buffer, 450 mM NaCl, 10 mM DTT, 20 uM Zn2+, 1 mM benzamidine, pH 6.5' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1JRM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1JRM _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1JRM _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1JRM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 'ver 1.8, 2001.030.21.27' processing Delaglio 1 DYANA 'ver 1.5' 'structure solution' Guentert 2 DYANA 'VER 1.5' refinement GUENTERT 3 # _exptl.entry_id 1JRM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1JRM _struct.title 'NMR structure of MTH0637. Ontario Centre for Structural Proteomics target MTH0637_1_104; Northeast Structural Genomics Target TT135' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JRM _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;alpha-beta protein, STRUCTURAL GENOMICS, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, PSI, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 51 ? GLY A 65 ? LYS A 51 GLY A 65 1 ? 15 HELX_P HELX_P2 2 GLY A 73 ? SER A 76 ? GLY A 73 SER A 76 5 ? 4 HELX_P HELX_P3 3 GLY A 87 ? LYS A 98 ? GLY A 87 LYS A 98 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 7 ? VAL A 10 ? LEU A 7 VAL A 10 A 2 ASP A 13 ? GLU A 19 ? ASP A 13 GLU A 19 A 3 GLN A 78 ? GLN A 84 ? GLN A 78 GLN A 84 A 4 ASP A 67 ? ILE A 70 ? ASP A 67 ILE A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 8 ? N ARG A 8 O LEU A 15 ? O LEU A 15 A 2 3 N LEU A 14 ? N LEU A 14 O ILE A 83 ? O ILE A 83 A 3 4 O ARG A 82 ? O ARG A 82 N GLU A 69 ? N GLU A 69 # _database_PDB_matrix.entry_id 1JRM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JRM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 PRO 104 104 104 PRO PRO A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-02-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_related 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_related.db_name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ARG 8 ? ? O A LEU 15 ? ? 1.18 2 1 H A VAL 71 ? ? O A THR 80 ? ? 1.19 3 1 O A GLU 59 ? ? H A THR 63 ? ? 1.24 4 1 HD2 A PRO 46 ? ? HD3 A PRO 47 ? ? 1.30 5 1 HB3 A SER 72 ? ? HA A LYS 79 ? ? 1.33 6 1 HA A ALA 23 ? ? O A LYS 42 ? ? 1.39 7 1 O A GLU 55 ? ? H A GLU 59 ? ? 1.41 8 1 O A LEU 94 ? ? H A LYS 98 ? ? 1.42 9 1 O A ASP 89 ? ? H A LYS 93 ? ? 1.42 10 1 HG A SER 61 ? ? O A ARG 66 ? ? 1.43 11 1 O A GLU 69 ? ? H A ARG 82 ? ? 1.45 12 1 O A LEU 14 ? ? H A ILE 83 ? ? 1.47 13 1 O A LEU 92 ? ? H A SER 96 ? ? 1.49 14 1 H A LEU 14 ? ? O A ILE 83 ? ? 1.49 15 1 O A LYS 51 ? ? H A GLU 55 ? ? 1.51 16 1 O A ILE 56 ? ? HB2 A PHE 60 ? ? 1.55 17 1 O A LYS 93 ? ? H A GLU 97 ? ? 1.59 18 1 O A GLN 74 ? ? H A ARG 77 ? ? 1.60 19 1 N A VAL 71 ? ? O A THR 80 ? ? 2.10 20 1 N A ARG 8 ? ? O A LEU 15 ? ? 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 3 ? ? -168.29 25.53 2 1 CYS A 6 ? ? 170.44 -27.97 3 1 VAL A 20 ? ? -67.29 89.74 4 1 SER A 21 ? ? -177.38 132.63 5 1 PRO A 22 ? ? -74.99 -93.50 6 1 ALA A 23 ? ? 176.05 120.14 7 1 LYS A 26 ? ? 69.82 105.96 8 1 PHE A 27 ? ? -38.76 104.78 9 1 LYS A 37 ? ? 44.58 24.02 10 1 HIS A 44 ? ? -72.30 -168.17 11 1 GLN A 48 ? ? -68.86 5.44 12 1 VAL A 71 ? ? -102.99 -143.34 13 1 SER A 72 ? ? 50.04 -118.57 14 1 ARG A 77 ? ? 71.35 -47.01 #