data_1K2H # _entry.id 1K2H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1K2H RCSB RCSB014477 WWPDB D_1000014477 # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 4285 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K2H _pdbx_database_status.recvd_initial_deposition_date 2001-09-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rustandi, R.R.' 1 'Baldisseri, D.M.' 2 'Inman, K.G.' 3 'Nizner, P.' 4 'Hamilton, S.M.' 5 'Landar, A.' 6 'Landar, A.' 7 'Zimmer, D.B.' 8 'Weber, D.J.' 9 # _citation.id primary _citation.title 'Three-dimensional solution structure of the calcium-signaling protein apo-S100A1 as determined by NMR.' _citation.journal_abbrev Biochemistry _citation.journal_volume 41 _citation.page_first 788 _citation.page_last 796 _citation.year 2002 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11790100 _citation.pdbx_database_id_DOI 10.1021/bi0118308 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Rustandi, R.R.' 1 primary 'Baldisseri, D.M.' 2 primary 'Inman, K.G.' 3 primary 'Nizner, P.' 4 primary 'Hamilton, S.M.' 5 primary 'Landar, A.' 6 primary 'Landar, A.' 7 primary 'Zimmer, D.B.' 8 primary 'Weber, D.J.' 9 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'S-100 protein, alpha chain' _entity.formula_weight 10439.614 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name S100A1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAA LTVACNNFFWENS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAA LTVACNNFFWENS ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLU n 1 4 LEU n 1 5 GLU n 1 6 THR n 1 7 ALA n 1 8 MET n 1 9 GLU n 1 10 THR n 1 11 LEU n 1 12 ILE n 1 13 ASN n 1 14 VAL n 1 15 PHE n 1 16 HIS n 1 17 ALA n 1 18 HIS n 1 19 SER n 1 20 GLY n 1 21 LYS n 1 22 GLU n 1 23 GLY n 1 24 ASP n 1 25 LYS n 1 26 TYR n 1 27 LYS n 1 28 LEU n 1 29 SER n 1 30 LYS n 1 31 LYS n 1 32 GLU n 1 33 LEU n 1 34 LYS n 1 35 ASP n 1 36 LEU n 1 37 LEU n 1 38 GLN n 1 39 THR n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 SER n 1 44 PHE n 1 45 LEU n 1 46 ASP n 1 47 VAL n 1 48 GLN n 1 49 LYS n 1 50 ASP n 1 51 ALA n 1 52 ASP n 1 53 ALA n 1 54 VAL n 1 55 ASP n 1 56 LYS n 1 57 ILE n 1 58 MET n 1 59 LYS n 1 60 GLU n 1 61 LEU n 1 62 ASP n 1 63 GLU n 1 64 ASN n 1 65 GLY n 1 66 ASP n 1 67 GLY n 1 68 GLU n 1 69 VAL n 1 70 ASP n 1 71 PHE n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 VAL n 1 76 VAL n 1 77 LEU n 1 78 VAL n 1 79 ALA n 1 80 ALA n 1 81 LEU n 1 82 THR n 1 83 VAL n 1 84 ALA n 1 85 CYS n 1 86 ASN n 1 87 ASN n 1 88 PHE n 1 89 PHE n 1 90 TRP n 1 91 GLU n 1 92 ASN n 1 93 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'HMS174(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-11b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S10A1_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAA LTVACNNFFWENS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P35467 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1K2H A 1 ? 93 ? P35467 1 ? 93 ? 1 93 2 1 1K2H B 1 ? 93 ? P35467 1 ? 93 ? 1 93 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 HNHA 3 1 1 '2D 1H-15N HSQC' 4 1 1 3D_15N_separated_HOHAHA 5 2 1 4D_13C-separated_NOESY 6 2 1 '3D HNCACB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;SAMPLE 1: S100A1, U-15N; 12-15mM d11-tris, 1-2mM EGTA, 0.3mM NaN3, 15-18mM NaCl; pH 6.4, 95% H2O, 5% D2O. SAMPLE 2: S100A1, U-13C,15N; 12-15mM d11-tris, 1-2mM EGTA, 0.3mM NaN3, 15-18mM NaCl; pH 6.4, 95% H2O, 5% D2O. ; '95% H2O/5% D2O' 2 'S100A1, U-13C,15N; 12-15mM d11-tris, 1-2mM EGTA, 0.3mM NaN3, 15-18mM NaCl; pH 6.4, 95% H2O, 5% D2O' '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Bruker DRX 800 # _pdbx_nmr_refine.entry_id 1K2H _pdbx_nmr_refine.method ;distance geometry, simulated annealing, docking, molecular dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1K2H _pdbx_nmr_details.text 'This structure was determined using constraints generated from heteronuclear, multi-dimensional NMR experiments.' # _pdbx_nmr_ensemble.entry_id 1K2H _pdbx_nmr_ensemble.conformers_calculated_total_number 75 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1K2H _pdbx_nmr_representative.conformer_id 17 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XWINNMR 2.6 collection 'Bruker Analytik GmbH' 1 NMRPipe 1.8 processing 'F. Delaglio' 2 X-PLOR 3.851 'structure solution' 'A. Brunger' 3 CHARMM ? 'structure solution' 'Harvard University' 4 CHARMM ? refinement 'Harvard University' 5 # _exptl.entry_id 1K2H _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _struct.entry_id 1K2H _struct.title 'Three-dimensional Solution Structure of apo-S100A1.' _struct.pdbx_descriptor S100A1 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K2H _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Non-covalent homodimer, X-type four-helix bundle, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 3 ? ALA A 17 ? GLU A 3 ALA A 17 1 ? 15 HELX_P HELX_P2 2 LYS A 30 ? GLN A 38 ? LYS A 30 GLN A 38 1 ? 9 HELX_P HELX_P3 3 ALA A 51 ? LEU A 61 ? ALA A 51 LEU A 61 1 ? 11 HELX_P HELX_P4 4 PHE A 71 ? ALA A 84 ? PHE A 71 ALA A 84 1 ? 14 HELX_P HELX_P5 5 GLU B 3 ? ALA B 17 ? GLU B 3 ALA B 17 1 ? 15 HELX_P HELX_P6 6 LYS B 30 ? GLN B 38 ? LYS B 30 GLN B 38 1 ? 9 HELX_P HELX_P7 7 ALA B 51 ? LEU B 61 ? ALA B 51 LEU B 61 1 ? 11 HELX_P HELX_P8 8 PHE B 71 ? ALA B 84 ? PHE B 71 ALA B 84 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 27 ? SER A 29 ? LYS A 27 SER A 29 A 2 GLU A 68 ? ASP A 70 ? GLU A 68 ASP A 70 B 1 LYS B 27 ? SER B 29 ? LYS B 27 SER B 29 B 2 GLU B 68 ? ASP B 70 ? GLU B 68 ASP B 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 28 ? O LEU A 28 N VAL A 69 ? N VAL A 69 B 1 2 O LEU B 28 ? O LEU B 28 N VAL B 69 ? N VAL B 69 # _database_PDB_matrix.entry_id 1K2H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1K2H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 SER 93 93 93 SER SER A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 GLU 3 3 3 GLU GLU B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 THR 6 6 6 THR THR B . n B 1 7 ALA 7 7 7 ALA ALA B . n B 1 8 MET 8 8 8 MET MET B . n B 1 9 GLU 9 9 9 GLU GLU B . n B 1 10 THR 10 10 10 THR THR B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 ASN 13 13 13 ASN ASN B . n B 1 14 VAL 14 14 14 VAL VAL B . n B 1 15 PHE 15 15 15 PHE PHE B . n B 1 16 HIS 16 16 16 HIS HIS B . n B 1 17 ALA 17 17 17 ALA ALA B . n B 1 18 HIS 18 18 18 HIS HIS B . n B 1 19 SER 19 19 19 SER SER B . n B 1 20 GLY 20 20 20 GLY GLY B . n B 1 21 LYS 21 21 21 LYS LYS B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 GLY 23 23 23 GLY GLY B . n B 1 24 ASP 24 24 24 ASP ASP B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 TYR 26 26 26 TYR TYR B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 SER 29 29 29 SER SER B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 GLU 32 32 32 GLU GLU B . n B 1 33 LEU 33 33 33 LEU LEU B . n B 1 34 LYS 34 34 34 LYS LYS B . n B 1 35 ASP 35 35 35 ASP ASP B . n B 1 36 LEU 36 36 36 LEU LEU B . n B 1 37 LEU 37 37 37 LEU LEU B . n B 1 38 GLN 38 38 38 GLN GLN B . n B 1 39 THR 39 39 39 THR THR B . n B 1 40 GLU 40 40 40 GLU GLU B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 SER 42 42 42 SER SER B . n B 1 43 SER 43 43 43 SER SER B . n B 1 44 PHE 44 44 44 PHE PHE B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 ASP 46 46 46 ASP ASP B . n B 1 47 VAL 47 47 47 VAL VAL B . n B 1 48 GLN 48 48 48 GLN GLN B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 ASP 50 50 50 ASP ASP B . n B 1 51 ALA 51 51 51 ALA ALA B . n B 1 52 ASP 52 52 52 ASP ASP B . n B 1 53 ALA 53 53 53 ALA ALA B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 ASP 55 55 55 ASP ASP B . n B 1 56 LYS 56 56 56 LYS LYS B . n B 1 57 ILE 57 57 57 ILE ILE B . n B 1 58 MET 58 58 58 MET MET B . n B 1 59 LYS 59 59 59 LYS LYS B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 LEU 61 61 61 LEU LEU B . n B 1 62 ASP 62 62 62 ASP ASP B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 ASN 64 64 64 ASN ASN B . n B 1 65 GLY 65 65 65 GLY GLY B . n B 1 66 ASP 66 66 66 ASP ASP B . n B 1 67 GLY 67 67 67 GLY GLY B . n B 1 68 GLU 68 68 68 GLU GLU B . n B 1 69 VAL 69 69 69 VAL VAL B . n B 1 70 ASP 70 70 70 ASP ASP B . n B 1 71 PHE 71 71 71 PHE PHE B . n B 1 72 GLN 72 72 72 GLN GLN B . n B 1 73 GLU 73 73 73 GLU GLU B . n B 1 74 PHE 74 74 74 PHE PHE B . n B 1 75 VAL 75 75 75 VAL VAL B . n B 1 76 VAL 76 76 76 VAL VAL B . n B 1 77 LEU 77 77 77 LEU LEU B . n B 1 78 VAL 78 78 78 VAL VAL B . n B 1 79 ALA 79 79 79 ALA ALA B . n B 1 80 ALA 80 80 80 ALA ALA B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 THR 82 82 82 THR THR B . n B 1 83 VAL 83 83 83 VAL VAL B . n B 1 84 ALA 84 84 84 ALA ALA B . n B 1 85 CYS 85 85 85 CYS CYS B . n B 1 86 ASN 86 86 86 ASN ASN B . n B 1 87 ASN 87 87 87 ASN ASN B . n B 1 88 PHE 88 88 88 PHE PHE B . n B 1 89 PHE 89 89 89 PHE PHE B . n B 1 90 TRP 90 90 90 TRP TRP B . n B 1 91 GLU 91 91 91 GLU GLU B . n B 1 92 ASN 92 92 92 ASN ASN B . n B 1 93 SER 93 93 93 SER SER B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-02-13 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Structure summary' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR ; 700 ;SHEET DETERMINATION METHOD: AUTHOR ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE21 A GLN 72 ? ? HA B ALA 80 ? ? 1.24 2 1 HA A ALA 80 ? ? HE21 B GLN 72 ? ? 1.26 3 1 HG A SER 2 ? ? H A GLU 5 ? ? 1.29 4 1 HG B SER 2 ? ? H B GLU 5 ? ? 1.33 5 1 H A LYS 49 ? ? O A ALA 84 ? ? 1.36 6 1 H B LYS 49 ? ? O B ALA 84 ? ? 1.36 7 1 O A PHE 89 ? ? H A GLU 91 ? ? 1.46 8 1 O B PHE 89 ? ? H B GLU 91 ? ? 1.46 9 1 O B LEU 41 ? ? H B PHE 44 ? ? 1.52 10 1 O A LEU 41 ? ? H A PHE 44 ? ? 1.52 11 1 O A ASN 64 ? ? H A GLY 67 ? ? 1.52 12 1 O B ASN 64 ? ? H B GLY 67 ? ? 1.52 13 2 O A CYS 85 ? ? H A ASN 87 ? ? 1.36 14 2 O B CYS 85 ? ? H B ASN 87 ? ? 1.36 15 2 O B ASN 64 ? ? H B GLY 67 ? ? 1.45 16 2 O A ASN 64 ? ? H A GLY 67 ? ? 1.45 17 2 O B ASP 70 ? ? H B PHE 74 ? ? 1.60 18 2 O A ASP 70 ? ? H A PHE 74 ? ? 1.60 19 3 O A ASN 64 ? ? H A GLY 67 ? ? 1.48 20 3 O B ASN 64 ? ? H B GLY 67 ? ? 1.48 21 3 O A CYS 85 ? ? H A ASN 87 ? ? 1.53 22 3 O B CYS 85 ? ? H B ASN 87 ? ? 1.54 23 3 H B LYS 49 ? ? O B ALA 84 ? ? 1.56 24 4 O A SER 43 ? ? H A ASP 46 ? ? 1.50 25 4 O B SER 29 ? ? H B LEU 33 ? ? 1.50 26 4 O A SER 29 ? ? H A LEU 33 ? ? 1.50 27 4 O A LEU 41 ? ? H A PHE 44 ? ? 1.50 28 4 O B SER 43 ? ? H B ASP 46 ? ? 1.50 29 4 O B LEU 41 ? ? H B PHE 44 ? ? 1.50 30 4 O B CYS 85 ? ? H B ASN 87 ? ? 1.55 31 4 O A CYS 85 ? ? H A ASN 87 ? ? 1.55 32 4 H A LYS 31 ? ? O A GLY 65 ? ? 1.57 33 4 H B LYS 31 ? ? O B GLY 65 ? ? 1.57 34 4 H A LYS 49 ? ? O A ALA 84 ? ? 1.59 35 4 H B LYS 49 ? ? O B ALA 84 ? ? 1.59 36 5 O B ASN 64 ? ? H B GLY 67 ? ? 1.52 37 5 O A ASN 64 ? ? H A GLY 67 ? ? 1.53 38 5 OD1 B ASP 70 ? ? H B PHE 71 ? ? 1.58 39 5 OD1 A ASP 70 ? ? H A PHE 71 ? ? 1.58 40 5 OE2 A GLU 40 ? ? CB B SER 2 ? ? 2.14 41 5 CB A SER 2 ? ? OE2 B GLU 40 ? ? 2.15 42 6 H A LYS 49 ? ? O A ALA 84 ? ? 1.33 43 6 H B LYS 49 ? ? O B ALA 84 ? ? 1.33 44 6 O A PHE 89 ? ? H A GLU 91 ? ? 1.40 45 6 O B PHE 89 ? ? H B GLU 91 ? ? 1.41 46 6 O A LEU 41 ? ? H A PHE 44 ? ? 1.48 47 6 O B LEU 41 ? ? H B PHE 44 ? ? 1.48 48 6 OD1 B ASP 70 ? ? H B PHE 71 ? ? 1.59 49 6 OD1 A ASP 70 ? ? H A PHE 71 ? ? 1.59 50 6 O A GLU 40 ? ? OE1 B GLU 5 ? ? 1.90 51 6 OE1 A GLU 5 ? ? O B GLU 40 ? ? 1.91 52 7 H A LYS 49 ? ? O A ALA 84 ? ? 1.54 53 7 H B LYS 49 ? ? O B ALA 84 ? ? 1.54 54 8 H A LEU 4 ? ? OE2 B GLU 40 ? ? 1.30 55 8 OE2 A GLU 40 ? ? H B LEU 4 ? ? 1.30 56 8 HZ3 A LYS 30 ? ? O A ASN 64 ? ? 1.47 57 8 HZ2 B LYS 30 ? ? O B ASN 64 ? ? 1.50 58 8 O B CYS 85 ? ? H B ASN 87 ? ? 1.51 59 8 O A CYS 85 ? ? H A ASN 87 ? ? 1.51 60 8 H A LYS 49 ? ? O A ALA 84 ? ? 1.53 61 8 H B LYS 49 ? ? O B ALA 84 ? ? 1.54 62 8 O A ASN 64 ? ? H A GLY 67 ? ? 1.58 63 8 O B ASN 64 ? ? H B GLY 67 ? ? 1.58 64 8 OE2 A GLU 40 ? ? N B LEU 4 ? ? 2.14 65 8 N A LEU 4 ? ? OE2 B GLU 40 ? ? 2.14 66 8 CG A GLU 40 ? ? OG B SER 2 ? ? 2.15 67 8 OG A SER 2 ? ? CG B GLU 40 ? ? 2.18 68 9 OE2 A GLU 40 ? ? HG B SER 2 ? ? 1.26 69 9 H B LYS 49 ? ? O B ALA 84 ? ? 1.45 70 9 H A LYS 49 ? ? O A ALA 84 ? ? 1.45 71 9 O A ASN 64 ? ? H A GLY 67 ? ? 1.53 72 9 O B ASN 64 ? ? H B GLY 67 ? ? 1.53 73 9 OG A SER 2 ? ? OE2 B GLU 40 ? ? 2.19 74 10 O A CYS 85 ? ? H A ASN 87 ? ? 1.38 75 10 O B CYS 85 ? ? H B ASN 87 ? ? 1.38 76 10 O B ASN 64 ? ? H B GLY 67 ? ? 1.47 77 10 O A ASN 64 ? ? H A GLY 67 ? ? 1.47 78 10 H B LYS 49 ? ? O B ALA 84 ? ? 1.48 79 10 H A LYS 49 ? ? O A ALA 84 ? ? 1.48 80 11 O B CYS 85 ? ? H B ASN 87 ? ? 1.38 81 11 O A CYS 85 ? ? H A ASN 87 ? ? 1.38 82 11 H A LYS 49 ? ? O A ALA 84 ? ? 1.50 83 11 O A ASN 64 ? ? H A GLY 67 ? ? 1.51 84 11 H B LYS 49 ? ? O B ALA 84 ? ? 1.51 85 11 O B ASN 64 ? ? H B GLY 67 ? ? 1.52 86 11 HG A SER 19 ? ? O A TYR 26 ? ? 1.59 87 11 O A LEU 37 ? ? H A LEU 41 ? ? 1.59 88 11 O B LEU 37 ? ? H B LEU 41 ? ? 1.59 89 12 O A CYS 85 ? ? H A ASN 87 ? ? 1.45 90 12 O B CYS 85 ? ? H B ASN 87 ? ? 1.45 91 12 O B ASN 64 ? ? H B GLY 67 ? ? 1.51 92 12 O A ASN 64 ? ? H A GLY 67 ? ? 1.52 93 12 O A ASP 35 ? ? HG1 A THR 39 ? ? 1.57 94 12 H A LYS 49 ? ? O A ALA 84 ? ? 1.57 95 12 H B LYS 49 ? ? O B ALA 84 ? ? 1.57 96 12 OE1 A GLU 5 ? ? O B GLU 40 ? ? 2.15 97 12 O A GLU 40 ? ? OE1 B GLU 5 ? ? 2.15 98 13 O B CYS 85 ? ? H B ASN 87 ? ? 1.45 99 13 O A CYS 85 ? ? H A ASN 87 ? ? 1.45 100 13 O A ASN 64 ? ? H A GLY 67 ? ? 1.50 101 13 O B ASN 64 ? ? H B GLY 67 ? ? 1.51 102 13 HG A SER 19 ? ? O A LYS 27 ? ? 1.57 103 14 O A PHE 89 ? ? H A GLU 91 ? ? 1.36 104 14 O B PHE 89 ? ? H B GLU 91 ? ? 1.37 105 14 HZ2 B LYS 30 ? ? O B GLU 60 ? ? 1.39 106 14 HZ3 A LYS 30 ? ? O A GLU 60 ? ? 1.42 107 14 O B ASN 64 ? ? H B GLY 67 ? ? 1.48 108 14 O A ASN 64 ? ? H A GLY 67 ? ? 1.48 109 14 H B LYS 49 ? ? O B ALA 84 ? ? 1.51 110 14 H A LYS 49 ? ? O A ALA 84 ? ? 1.51 111 14 O B PHE 15 ? ? H B SER 19 ? ? 1.56 112 14 O A PHE 15 ? ? H A SER 19 ? ? 1.56 113 15 O B ASN 64 ? ? H B GLY 67 ? ? 1.45 114 15 O A ASN 64 ? ? H A GLY 67 ? ? 1.45 115 15 O B CYS 85 ? ? H B ASN 87 ? ? 1.47 116 15 O A CYS 85 ? ? H A ASN 87 ? ? 1.47 117 15 H B LYS 31 ? ? O B GLY 65 ? ? 1.49 118 15 H A LYS 31 ? ? O A GLY 65 ? ? 1.49 119 15 H A LYS 49 ? ? O A ALA 84 ? ? 1.51 120 15 H B LYS 49 ? ? O B ALA 84 ? ? 1.52 121 16 H A LYS 49 ? ? O A ALA 84 ? ? 1.45 122 16 H B LYS 49 ? ? O B ALA 84 ? ? 1.45 123 16 HZ3 A LYS 30 ? ? O A ASN 64 ? ? 1.46 124 16 O B CYS 85 ? ? H B ASN 87 ? ? 1.50 125 16 O A CYS 85 ? ? H A ASN 87 ? ? 1.51 126 16 OE2 A GLU 40 ? ? HG B SER 2 ? ? 1.55 127 16 O B THR 39 ? ? HG B SER 42 ? ? 1.55 128 16 O A ASP 70 ? ? H A PHE 74 ? ? 1.57 129 16 O A SER 2 ? ? HG1 A THR 6 ? ? 1.57 130 16 O B ASP 70 ? ? H B PHE 74 ? ? 1.57 131 17 H A LYS 49 ? ? O A ALA 84 ? ? 1.45 132 17 H B LYS 49 ? ? O B ALA 84 ? ? 1.45 133 17 O B ASP 35 ? ? HG1 B THR 39 ? ? 1.47 134 17 O A SER 19 ? ? H A GLU 22 ? ? 1.48 135 17 O B SER 19 ? ? H B GLU 22 ? ? 1.49 136 17 O B ASN 64 ? ? H B GLY 67 ? ? 1.54 137 17 O A ASN 64 ? ? H A GLY 67 ? ? 1.54 138 18 HZ2 A LYS 30 ? ? HD21 A ASN 64 ? ? 1.30 139 18 HZ2 B LYS 30 ? ? HD21 B ASN 64 ? ? 1.31 140 18 O B CYS 85 ? ? H B ASN 87 ? ? 1.43 141 18 O A CYS 85 ? ? H A ASN 87 ? ? 1.43 142 18 O B HIS 16 ? ? H B GLY 20 ? ? 1.50 143 18 O A HIS 16 ? ? H A GLY 20 ? ? 1.50 144 18 H A LYS 49 ? ? O A ALA 84 ? ? 1.50 145 18 H B LYS 49 ? ? O B ALA 84 ? ? 1.51 146 18 O B ASN 64 ? ? H B GLY 67 ? ? 1.59 147 18 O A ASN 64 ? ? H A GLY 67 ? ? 1.59 148 18 O B SER 43 ? ? H B ASP 46 ? ? 1.59 149 18 O A SER 43 ? ? H A ASP 46 ? ? 1.59 150 19 H A LYS 31 ? ? O A GLY 65 ? ? 1.46 151 19 H B LYS 31 ? ? O B GLY 65 ? ? 1.47 152 19 O B SER 19 ? ? H B GLU 22 ? ? 1.51 153 19 O A SER 19 ? ? H A GLU 22 ? ? 1.52 154 19 H B LYS 49 ? ? O B ALA 84 ? ? 1.55 155 19 H A LYS 49 ? ? O A ALA 84 ? ? 1.55 156 20 H B LYS 49 ? ? O B ALA 84 ? ? 1.32 157 20 H A LYS 49 ? ? O A ALA 84 ? ? 1.33 158 20 O A ASP 35 ? ? HG1 A THR 39 ? ? 1.46 159 20 O B ASN 64 ? ? H B GLY 67 ? ? 1.47 160 20 O A ASN 64 ? ? H A GLY 67 ? ? 1.47 161 20 OD1 B ASN 87 ? ? H B PHE 88 ? ? 1.56 162 20 OD1 A ASN 87 ? ? H A PHE 88 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 22 ? ? 85.62 -21.25 2 1 TYR A 26 ? ? -50.01 172.99 3 1 LEU A 28 ? ? 81.61 -176.06 4 1 LEU A 41 ? ? -86.40 39.24 5 1 VAL A 47 ? ? -166.24 87.08 6 1 LYS A 49 ? ? -108.97 -81.02 7 1 ASN A 64 ? ? -151.65 56.76 8 1 ASP A 70 ? ? -128.24 -154.74 9 1 ASN A 86 ? ? -57.59 -0.55 10 1 TRP A 90 ? ? -63.63 41.61 11 1 GLU B 22 ? ? 85.02 -21.02 12 1 TYR B 26 ? ? -49.96 173.16 13 1 LEU B 28 ? ? 81.51 -176.24 14 1 LEU B 41 ? ? -86.76 39.47 15 1 VAL B 47 ? ? -166.38 87.16 16 1 LYS B 49 ? ? -108.85 -80.89 17 1 ASN B 64 ? ? -151.56 56.42 18 1 ASP B 70 ? ? -128.24 -154.67 19 1 ASN B 86 ? ? -57.83 -0.50 20 1 TRP B 90 ? ? -63.82 40.86 21 2 TYR A 26 ? ? -49.30 175.27 22 2 LYS A 27 ? ? -57.63 -79.85 23 2 LEU A 28 ? ? -173.48 -177.06 24 2 LEU A 41 ? ? -96.20 33.02 25 2 ASN A 64 ? ? -155.35 58.06 26 2 ASP A 70 ? ? -128.84 -152.88 27 2 ASN A 86 ? ? -63.44 56.24 28 2 PHE A 88 ? ? -147.62 -69.92 29 2 TRP A 90 ? ? -94.60 41.87 30 2 TYR B 26 ? ? -49.17 175.02 31 2 LYS B 27 ? ? -57.34 -80.37 32 2 LEU B 28 ? ? -173.05 -177.12 33 2 LEU B 41 ? ? -96.17 32.66 34 2 LYS B 49 ? ? -80.47 -70.05 35 2 ASN B 64 ? ? -155.31 58.03 36 2 ASP B 70 ? ? -128.73 -152.84 37 2 ASN B 86 ? ? -63.52 56.24 38 2 PHE B 88 ? ? -147.44 -70.07 39 2 TRP B 90 ? ? -94.48 41.10 40 3 LYS A 27 ? ? -67.28 -80.33 41 3 LEU A 28 ? ? -173.18 -178.20 42 3 VAL A 47 ? ? -152.09 88.01 43 3 ASN A 64 ? ? -145.50 45.59 44 3 ASP A 70 ? ? -127.54 -158.44 45 3 ASN A 86 ? ? -67.42 35.63 46 3 LYS B 27 ? ? -68.35 -80.97 47 3 LEU B 28 ? ? -171.23 -178.81 48 3 LEU B 41 ? ? -99.53 32.84 49 3 VAL B 47 ? ? -151.84 89.32 50 3 ASN B 64 ? ? -145.94 45.41 51 3 ASP B 70 ? ? -127.63 -158.00 52 3 ASN B 86 ? ? -67.88 35.44 53 4 TYR A 26 ? ? -47.85 173.45 54 4 LYS A 27 ? ? -54.21 -76.85 55 4 LEU A 28 ? ? -171.31 -178.86 56 4 LEU A 41 ? ? -89.83 37.00 57 4 LYS A 49 ? ? -90.61 -80.12 58 4 ASN A 64 ? ? -154.24 70.81 59 4 ASP A 70 ? ? -122.31 -157.50 60 4 ASN A 86 ? ? -58.13 68.13 61 4 PHE A 88 ? ? -134.75 -90.82 62 4 TRP A 90 ? ? -73.22 48.43 63 4 TYR B 26 ? ? -47.96 173.35 64 4 LYS B 27 ? ? -54.07 -77.01 65 4 LEU B 28 ? ? -171.10 -178.52 66 4 LEU B 41 ? ? -89.99 37.49 67 4 LYS B 49 ? ? -90.83 -80.00 68 4 ASN B 64 ? ? -154.16 70.59 69 4 ASP B 70 ? ? -122.36 -157.50 70 4 ASN B 86 ? ? -58.04 67.92 71 4 PHE B 88 ? ? -134.69 -90.83 72 4 TRP B 90 ? ? -73.23 47.98 73 5 LYS A 21 ? ? -58.40 -9.76 74 5 GLU A 22 ? ? 72.96 -15.63 75 5 LYS A 27 ? ? -50.76 -91.79 76 5 LEU A 28 ? ? 176.41 -176.27 77 5 LEU A 41 ? ? -87.36 34.15 78 5 VAL A 47 ? ? -150.65 87.31 79 5 ASP A 70 ? ? -120.95 -161.80 80 5 TRP A 90 ? ? -88.95 43.47 81 5 GLU B 22 ? ? 73.31 -15.73 82 5 LYS B 27 ? ? -50.77 -91.44 83 5 LEU B 28 ? ? 176.09 -176.30 84 5 LEU B 41 ? ? -87.20 34.05 85 5 VAL B 47 ? ? -150.79 87.47 86 5 LYS B 49 ? ? -80.09 -70.01 87 5 ASP B 70 ? ? -121.06 -161.91 88 5 CYS B 85 ? ? -140.10 57.95 89 5 TRP B 90 ? ? -89.23 43.73 90 6 LYS A 27 ? ? -49.89 -89.50 91 6 LEU A 28 ? ? -179.80 -178.12 92 6 LEU A 41 ? ? -108.13 45.32 93 6 VAL A 47 ? ? -164.26 75.99 94 6 ASN A 64 ? ? -154.01 60.69 95 6 ASP A 70 ? ? -118.08 -164.15 96 6 ASN A 86 ? ? -61.89 2.92 97 6 TRP A 90 ? ? -59.89 46.42 98 6 TYR B 26 ? ? -49.87 164.12 99 6 LYS B 27 ? ? -49.82 -89.59 100 6 LEU B 28 ? ? -179.73 -178.23 101 6 LEU B 41 ? ? -108.13 45.31 102 6 VAL B 47 ? ? -164.46 76.11 103 6 ASN B 64 ? ? -154.31 60.87 104 6 ASP B 70 ? ? -118.04 -164.05 105 6 ASN B 86 ? ? -61.83 2.97 106 6 TRP B 90 ? ? -59.97 46.10 107 7 ASP A 24 ? ? -102.68 58.78 108 7 LYS A 27 ? ? -52.41 -93.39 109 7 LEU A 28 ? ? -179.96 -177.65 110 7 LEU A 45 ? ? -67.38 11.14 111 7 ASN A 64 ? ? -146.79 56.26 112 7 ASP A 70 ? ? -129.08 -154.15 113 7 ASN A 86 ? ? -66.65 1.80 114 7 TRP A 90 ? ? 36.05 75.79 115 7 ASP B 24 ? ? -102.63 58.99 116 7 LYS B 27 ? ? -52.25 -93.49 117 7 LEU B 28 ? ? -179.95 -177.41 118 7 LEU B 45 ? ? -67.01 10.56 119 7 ASN B 64 ? ? -146.92 56.09 120 7 ASP B 70 ? ? -129.13 -154.38 121 7 ASN B 86 ? ? -66.52 1.97 122 7 TRP B 90 ? ? 35.98 75.63 123 8 GLU A 22 ? ? 66.54 -17.33 124 8 TYR A 26 ? ? -49.68 170.15 125 8 LYS A 27 ? ? -58.53 -90.97 126 8 LEU A 28 ? ? 175.66 -177.44 127 8 LYS A 49 ? ? -80.80 -70.02 128 8 ASN A 64 ? ? -148.93 45.48 129 8 ASP A 70 ? ? -122.63 -158.60 130 8 ASN A 86 ? ? -63.85 31.45 131 8 PHE A 88 ? ? -135.93 -33.69 132 8 GLU B 22 ? ? 66.39 -17.37 133 8 TYR B 26 ? ? -49.67 170.10 134 8 LYS B 27 ? ? -58.40 -90.27 135 8 LEU B 28 ? ? 175.03 -177.46 136 8 ASN B 64 ? ? -148.76 45.50 137 8 ASP B 70 ? ? -122.82 -158.41 138 8 ASN B 86 ? ? -63.74 31.49 139 8 PHE B 88 ? ? -135.81 -34.13 140 9 TYR A 26 ? ? -48.74 170.30 141 9 LYS A 27 ? ? -50.55 -94.09 142 9 LEU A 28 ? ? 179.39 -178.80 143 9 SER A 29 ? ? -43.91 155.10 144 9 LYS A 49 ? ? -91.44 -79.92 145 9 ASP A 70 ? ? -128.12 -160.00 146 9 ASN A 86 ? ? -65.09 26.71 147 9 TRP A 90 ? ? 34.04 49.05 148 9 TYR B 26 ? ? -48.72 170.38 149 9 LYS B 27 ? ? -50.86 -94.16 150 9 LEU B 28 ? ? 179.48 -178.76 151 9 SER B 29 ? ? -44.00 155.20 152 9 LYS B 49 ? ? -91.62 -80.01 153 9 ASP B 70 ? ? -128.51 -159.99 154 9 ASN B 86 ? ? -64.92 26.98 155 9 TRP B 90 ? ? 34.19 48.57 156 10 LYS A 21 ? ? -68.72 2.27 157 10 TYR A 26 ? ? -49.70 168.49 158 10 LYS A 27 ? ? -51.60 -93.10 159 10 LEU A 28 ? ? -179.33 -176.81 160 10 LEU A 41 ? ? -90.40 33.62 161 10 LEU A 45 ? ? -58.74 -2.33 162 10 ASN A 64 ? ? -159.70 64.07 163 10 ASP A 70 ? ? -130.02 -159.24 164 10 ASN A 86 ? ? -63.63 41.35 165 10 PHE A 88 ? ? -126.60 -56.33 166 10 TRP A 90 ? ? -88.14 46.32 167 10 LYS B 21 ? ? -68.72 2.40 168 10 TYR B 26 ? ? -49.56 168.54 169 10 LYS B 27 ? ? -51.73 -93.10 170 10 LEU B 28 ? ? -179.29 -176.84 171 10 LEU B 41 ? ? -90.61 33.57 172 10 LEU B 45 ? ? -58.85 -2.24 173 10 ASN B 64 ? ? -159.72 64.17 174 10 ASP B 70 ? ? -130.02 -159.23 175 10 ASN B 86 ? ? -63.72 41.58 176 10 PHE B 88 ? ? -126.67 -56.12 177 10 TRP B 90 ? ? -88.19 46.35 178 11 TYR A 26 ? ? -49.99 171.03 179 11 LYS A 27 ? ? -56.89 -80.97 180 11 LEU A 41 ? ? -95.12 31.58 181 11 LEU A 45 ? ? -57.39 -5.43 182 11 LYS A 49 ? ? -90.02 -79.76 183 11 ASN A 64 ? ? -159.45 53.34 184 11 ASP A 70 ? ? -124.96 -155.56 185 11 ASN A 86 ? ? -66.28 50.64 186 11 PHE A 88 ? ? -141.12 -82.28 187 11 TRP A 90 ? ? -87.74 43.72 188 11 TYR B 26 ? ? -50.18 171.06 189 11 LYS B 27 ? ? -56.88 -81.06 190 11 LEU B 41 ? ? -95.84 31.43 191 11 LEU B 45 ? ? -57.84 -5.23 192 11 LYS B 49 ? ? -89.93 -79.95 193 11 ASN B 64 ? ? -158.99 53.71 194 11 ASP B 70 ? ? -124.67 -154.94 195 11 ASN B 86 ? ? -66.00 49.61 196 11 PHE B 88 ? ? -141.15 -82.34 197 11 TRP B 90 ? ? -87.39 42.58 198 12 GLU A 22 ? ? 64.57 -26.41 199 12 TYR A 26 ? ? -54.52 -172.42 200 12 LYS A 27 ? ? -67.10 -80.39 201 12 LEU A 45 ? ? -62.35 2.50 202 12 LYS A 49 ? ? -91.66 -74.97 203 12 ASN A 64 ? ? -169.08 73.88 204 12 ASP A 70 ? ? -128.12 -160.11 205 12 CYS A 85 ? ? -147.74 52.62 206 12 ASN A 86 ? ? -67.55 46.77 207 12 TRP A 90 ? ? -96.48 41.15 208 12 GLU B 22 ? ? 64.68 -26.33 209 12 TYR B 26 ? ? -54.71 -172.58 210 12 LYS B 27 ? ? -66.77 -80.61 211 12 LEU B 45 ? ? -61.93 2.42 212 12 LYS B 49 ? ? -91.44 -75.18 213 12 ASN B 64 ? ? -169.27 74.16 214 12 ASP B 70 ? ? -128.08 -160.25 215 12 CYS B 85 ? ? -147.79 52.40 216 12 ASN B 86 ? ? -67.52 46.67 217 12 TRP B 90 ? ? -96.28 40.99 218 13 GLU A 22 ? ? 79.40 -15.65 219 13 TYR A 26 ? ? -51.38 175.35 220 13 LYS A 27 ? ? -56.26 -79.72 221 13 LEU A 41 ? ? -92.12 32.35 222 13 VAL A 47 ? ? -163.69 93.06 223 13 ASN A 64 ? ? -157.91 51.01 224 13 ASP A 70 ? ? -123.16 -162.03 225 13 ASN A 86 ? ? -65.68 38.62 226 13 GLU B 22 ? ? 80.55 -16.69 227 13 TYR B 26 ? ? -52.46 175.33 228 13 LYS B 27 ? ? -55.34 -81.03 229 13 SER B 29 ? ? -49.22 153.73 230 13 LEU B 41 ? ? -90.74 32.97 231 13 VAL B 47 ? ? -164.05 92.98 232 13 ASN B 64 ? ? -157.40 51.31 233 13 ASP B 70 ? ? -122.91 -161.38 234 13 ASN B 86 ? ? -64.97 38.02 235 14 LYS A 27 ? ? -52.45 -93.92 236 14 LEU A 28 ? ? 179.05 -177.21 237 14 ASN A 64 ? ? -143.08 39.47 238 14 ASP A 70 ? ? -120.73 -158.25 239 14 ASN A 86 ? ? -60.09 5.93 240 14 ASN A 87 ? ? -46.22 107.07 241 14 PHE A 89 ? ? -73.38 20.41 242 14 TRP A 90 ? ? -57.22 40.24 243 14 LYS B 27 ? ? -52.35 -93.55 244 14 LEU B 28 ? ? 178.50 -177.16 245 14 ASN B 64 ? ? -143.05 39.07 246 14 ASP B 70 ? ? -120.56 -158.27 247 14 ASN B 86 ? ? -60.19 5.84 248 14 ASN B 87 ? ? -46.24 107.02 249 14 PHE B 89 ? ? -73.39 20.54 250 14 TRP B 90 ? ? -57.37 39.71 251 15 LYS A 27 ? ? -49.83 -93.37 252 15 LEU A 28 ? ? 177.46 -177.14 253 15 ASN A 64 ? ? -173.18 76.99 254 15 ASP A 70 ? ? -128.55 -157.46 255 15 ASN A 86 ? ? -68.84 42.33 256 15 PHE A 88 ? ? -138.72 -61.11 257 15 TRP A 90 ? ? -88.70 45.04 258 15 LYS B 27 ? ? -49.49 -93.42 259 15 LEU B 28 ? ? 177.28 -177.15 260 15 ASN B 64 ? ? -173.34 76.55 261 15 ASP B 70 ? ? -128.63 -157.79 262 15 ASN B 86 ? ? -68.83 42.51 263 15 PHE B 88 ? ? -138.53 -61.21 264 15 TRP B 90 ? ? -89.15 45.14 265 16 GLU A 22 ? ? 60.67 -4.95 266 16 TYR A 26 ? ? -52.58 171.07 267 16 LYS A 27 ? ? -51.88 -89.67 268 16 LEU A 28 ? ? 177.55 -178.53 269 16 LYS A 49 ? ? -97.05 -66.66 270 16 ASN A 64 ? ? -159.55 67.82 271 16 ASN A 86 ? ? -68.32 37.98 272 16 PHE A 88 ? ? -93.68 -68.35 273 16 GLU B 22 ? ? 60.93 -5.00 274 16 TYR B 26 ? ? -52.20 171.26 275 16 LYS B 27 ? ? -52.30 -89.56 276 16 LEU B 28 ? ? 177.84 -178.35 277 16 LYS B 49 ? ? -97.26 -66.28 278 16 ASN B 64 ? ? -159.70 67.67 279 16 ASN B 86 ? ? -68.14 37.88 280 16 PHE B 88 ? ? -93.74 -67.92 281 17 LYS A 27 ? ? -49.24 -91.41 282 17 LEU A 28 ? ? 176.45 -176.96 283 17 LYS A 49 ? ? -79.94 -70.00 284 17 ASN A 64 ? ? -152.05 61.41 285 17 ASP A 70 ? ? -127.12 -159.11 286 17 ASN A 86 ? ? -58.01 2.23 287 17 ASN A 87 ? ? -49.90 106.24 288 17 TRP A 90 ? ? 23.95 43.12 289 17 LYS B 27 ? ? -49.37 -91.36 290 17 LEU B 28 ? ? 176.63 -176.88 291 17 LYS B 49 ? ? -80.01 -70.04 292 17 ASN B 64 ? ? -152.09 61.33 293 17 ASP B 70 ? ? -127.02 -159.05 294 17 ASN B 86 ? ? -58.10 2.17 295 17 ASN B 87 ? ? -49.94 106.26 296 17 TRP B 90 ? ? 24.14 42.52 297 18 TYR A 26 ? ? -49.94 169.55 298 18 LYS A 27 ? ? -52.99 -85.36 299 18 LEU A 28 ? ? 177.26 -175.14 300 18 VAL A 47 ? ? -161.63 68.16 301 18 LYS A 49 ? ? -89.14 -72.62 302 18 ASP A 70 ? ? -129.10 -158.05 303 18 ASN A 86 ? ? -67.62 44.11 304 18 PHE A 88 ? ? -128.10 -61.10 305 18 TRP A 90 ? ? -90.29 45.07 306 18 TYR B 26 ? ? -49.91 169.53 307 18 LYS B 27 ? ? -53.02 -85.45 308 18 LEU B 28 ? ? 177.35 -175.03 309 18 VAL B 47 ? ? -161.86 68.10 310 18 LYS B 49 ? ? -89.24 -71.97 311 18 ASP B 70 ? ? -129.02 -158.00 312 18 ASN B 86 ? ? -67.42 44.11 313 18 PHE B 88 ? ? -127.97 -61.10 314 18 TRP B 90 ? ? -90.15 44.84 315 19 LYS A 27 ? ? -52.06 -82.77 316 19 LEU A 28 ? ? -174.01 -179.33 317 19 LEU A 41 ? ? -98.34 33.75 318 19 LYS A 49 ? ? -80.07 -70.26 319 19 ASN A 64 ? ? -154.72 67.19 320 19 ASP A 70 ? ? -125.27 -158.71 321 19 CYS A 85 ? ? -141.27 59.33 322 19 LYS B 27 ? ? -52.25 -82.76 323 19 LEU B 28 ? ? -173.92 -179.46 324 19 LEU B 41 ? ? -97.87 33.81 325 19 LYS B 49 ? ? -79.98 -70.74 326 19 ASN B 64 ? ? -154.81 67.18 327 19 ASP B 70 ? ? -125.41 -158.66 328 19 CYS B 85 ? ? -141.26 59.24 329 20 TYR A 26 ? ? -48.62 161.17 330 20 LYS A 27 ? ? -50.78 -85.27 331 20 LEU A 28 ? ? 173.00 -175.32 332 20 LEU A 41 ? ? -104.77 42.22 333 20 VAL A 47 ? ? -157.07 82.46 334 20 ASN A 64 ? ? -151.13 54.36 335 20 ASP A 70 ? ? -127.27 -160.28 336 20 CYS A 85 ? ? -140.18 58.33 337 20 ASN A 86 ? ? -48.38 -18.99 338 20 ASN A 87 ? ? 47.13 172.86 339 20 PHE A 88 ? ? -179.78 -65.36 340 20 TYR B 26 ? ? -48.43 161.34 341 20 LYS B 27 ? ? -50.94 -85.09 342 20 LEU B 28 ? ? 172.77 -175.40 343 20 LEU B 41 ? ? -104.54 42.40 344 20 VAL B 47 ? ? -157.17 82.23 345 20 ASN B 64 ? ? -151.16 54.44 346 20 ASP B 70 ? ? -127.49 -160.58 347 20 CYS B 85 ? ? -140.25 58.43 348 20 ASN B 86 ? ? -48.41 -19.08 349 20 ASN B 87 ? ? 47.00 172.59 350 20 PHE B 88 ? ? -179.66 -65.14 #