data_1K2M # _entry.id 1K2M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1K2M pdb_00001k2m 10.2210/pdb1k2m/pdb RCSB RCSB014482 ? ? WWPDB D_1000014482 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-12-05 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 2 0 2023-11-15 6 'Structure model' 2 1 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Atomic model' 7 5 'Structure model' 'Data collection' 8 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' atom_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 6 'Structure model' pdbx_entry_details 11 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_atom_site.auth_atom_id' 7 5 'Structure model' '_atom_site.label_atom_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K2M _pdbx_database_status.recvd_initial_deposition_date 2001-09-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FHR '1FHR contains the same FHA2-pTyr peptide complex.' unspecified PDB 1FHQ '1FHQ contains the same protein in a peptide-free state.' unspecified PDB 1DMZ '1DMZ contains the same protein in a peptide-free state.' unspecified PDB 1QU5 '1QU5 contains the same protein in a peptide-free state.' unspecified PDB 1J4K '1J4K contains the minimized average structure for this ensemble.' unspecified PDB 1K2N '1K2N CONTAINS THE SAME PROTEIN complexed with a phosphothreonyl peptide derived from Rad9.' unspecified PDB 1J4L '1J4L contains the minimized average structure for the SAME PROTEIN complexed with a phosphothreonyl peptide derived from Rad9.' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Byeon, I.-J.L.' 1 'Yongkiettrakul, S.' 2 'Tsai, M.-D.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure of the yeast Rad53 FHA2 complexed with a phosphothreonine peptide pTXXL: comparison with the structures of FHA2-pYXL and FHA1-pTXXD complexes. ; J.Mol.Biol. 314 577 588 2001 JMOBAK UK 0022-2836 0070 ? 11846568 10.1006/jmbi.2001.5141 1 'II. Structure and Specificity of the Interaction between the FHA2 Domain of Rad53 and Phosphotyrosyl Peptides.' J.Mol.Biol. 302 927 940 2000 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.2000.4095 2 'Structure and Function of a New Phosphopeptide-binding Domain Containing the FHA2 of Rad53.' J.Mol.Biol. 294 1041 1049 1999 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1999.3313 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Byeon, I.J.' 1 ? primary 'Yongkiettrakul, S.' 2 ? primary 'Tsai, M.D.' 3 ? 1 'Wang, P.' 4 ? 1 'Byeon, I.J.' 5 ? 1 'Liao, H.' 6 ? 1 'Beebe, K.D.' 7 ? 1 'Yongkiettrakul, S.' 8 ? 1 'Pei, D.' 9 ? 1 'Tsai, M.D.' 10 ? 2 'Liao, H.' 11 ? 2 'Byeon, I.J.' 12 ? 2 'Tsai, M.D.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein Kinase SPK1' 18148.758 1 2.7.1.- ? 'C-terminal FHA domain (FHA2)' ? 2 polymer syn 'DNA repair protein Rad9' 1009.947 1 ? ? 'residues 826-832' ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHT GTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL ; ;GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHT GTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL ; A ? 2 'polypeptide(L)' no yes 'EDI(PTR)YLD' EDIYYLD P ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 GLY n 1 4 ARG n 1 5 PHE n 1 6 LEU n 1 7 THR n 1 8 LEU n 1 9 LYS n 1 10 PRO n 1 11 LEU n 1 12 PRO n 1 13 ASP n 1 14 SER n 1 15 ILE n 1 16 ILE n 1 17 GLN n 1 18 GLU n 1 19 SER n 1 20 LEU n 1 21 GLU n 1 22 ILE n 1 23 GLN n 1 24 GLN n 1 25 GLY n 1 26 VAL n 1 27 ASN n 1 28 PRO n 1 29 PHE n 1 30 PHE n 1 31 ILE n 1 32 GLY n 1 33 ARG n 1 34 SER n 1 35 GLU n 1 36 ASP n 1 37 CYS n 1 38 ASN n 1 39 CYS n 1 40 LYS n 1 41 ILE n 1 42 GLU n 1 43 ASP n 1 44 ASN n 1 45 ARG n 1 46 LEU n 1 47 SER n 1 48 ARG n 1 49 VAL n 1 50 HIS n 1 51 CYS n 1 52 PHE n 1 53 ILE n 1 54 PHE n 1 55 LYS n 1 56 LYS n 1 57 ARG n 1 58 HIS n 1 59 ALA n 1 60 VAL n 1 61 GLY n 1 62 LYS n 1 63 SER n 1 64 MET n 1 65 TYR n 1 66 GLU n 1 67 SER n 1 68 PRO n 1 69 ALA n 1 70 GLN n 1 71 GLY n 1 72 LEU n 1 73 ASP n 1 74 ASP n 1 75 ILE n 1 76 TRP n 1 77 TYR n 1 78 CYS n 1 79 HIS n 1 80 THR n 1 81 GLY n 1 82 THR n 1 83 ASN n 1 84 VAL n 1 85 SER n 1 86 TYR n 1 87 LEU n 1 88 ASN n 1 89 ASN n 1 90 ASN n 1 91 ARG n 1 92 MET n 1 93 ILE n 1 94 GLN n 1 95 GLY n 1 96 THR n 1 97 LYS n 1 98 PHE n 1 99 LEU n 1 100 LEU n 1 101 GLN n 1 102 ASP n 1 103 GLY n 1 104 ASP n 1 105 GLU n 1 106 ILE n 1 107 LYS n 1 108 ILE n 1 109 ILE n 1 110 TRP n 1 111 ASP n 1 112 LYS n 1 113 ASN n 1 114 ASN n 1 115 LYS n 1 116 PHE n 1 117 VAL n 1 118 ILE n 1 119 GLY n 1 120 PHE n 1 121 LYS n 1 122 VAL n 1 123 GLU n 1 124 ILE n 1 125 ASN n 1 126 ASP n 1 127 THR n 1 128 THR n 1 129 GLY n 1 130 LEU n 1 131 PHE n 1 132 ASN n 1 133 GLU n 1 134 GLY n 1 135 LEU n 1 136 GLY n 1 137 MET n 1 138 LEU n 1 139 GLN n 1 140 GLU n 1 141 GLN n 1 142 ARG n 1 143 VAL n 1 144 VAL n 1 145 LEU n 1 146 LYS n 1 147 GLN n 1 148 THR n 1 149 ALA n 1 150 GLU n 1 151 GLU n 1 152 LYS n 1 153 ASP n 1 154 LEU n 1 155 VAL n 1 156 LYS n 1 157 LYS n 1 158 LEU n 2 1 GLU n 2 2 ASP n 2 3 ILE n 2 4 PTR n 2 5 TYR n 2 6 LEU n 2 7 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene 'SPK1 or RAD53' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This phosphotyrosyl peptide was chemically synthesized.' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 573 573 GLY GLY A . n A 1 2 ASN 2 574 574 ASN ASN A . n A 1 3 GLY 3 575 575 GLY GLY A . n A 1 4 ARG 4 576 576 ARG ARG A . n A 1 5 PHE 5 577 577 PHE PHE A . n A 1 6 LEU 6 578 578 LEU LEU A . n A 1 7 THR 7 579 579 THR THR A . n A 1 8 LEU 8 580 580 LEU LEU A . n A 1 9 LYS 9 581 581 LYS LYS A . n A 1 10 PRO 10 582 582 PRO PRO A . n A 1 11 LEU 11 583 583 LEU LEU A . n A 1 12 PRO 12 584 584 PRO PRO A . n A 1 13 ASP 13 585 585 ASP ASP A . n A 1 14 SER 14 586 586 SER SER A . n A 1 15 ILE 15 587 587 ILE ILE A . n A 1 16 ILE 16 588 588 ILE ILE A . n A 1 17 GLN 17 589 589 GLN GLN A . n A 1 18 GLU 18 590 590 GLU GLU A . n A 1 19 SER 19 591 591 SER SER A . n A 1 20 LEU 20 592 592 LEU LEU A . n A 1 21 GLU 21 593 593 GLU GLU A . n A 1 22 ILE 22 594 594 ILE ILE A . n A 1 23 GLN 23 595 595 GLN GLN A . n A 1 24 GLN 24 596 596 GLN GLN A . n A 1 25 GLY 25 597 597 GLY GLY A . n A 1 26 VAL 26 598 598 VAL VAL A . n A 1 27 ASN 27 599 599 ASN ASN A . n A 1 28 PRO 28 600 600 PRO PRO A . n A 1 29 PHE 29 601 601 PHE PHE A . n A 1 30 PHE 30 602 602 PHE PHE A . n A 1 31 ILE 31 603 603 ILE ILE A . n A 1 32 GLY 32 604 604 GLY GLY A . n A 1 33 ARG 33 605 605 ARG ARG A . n A 1 34 SER 34 606 606 SER SER A . n A 1 35 GLU 35 607 607 GLU GLU A . n A 1 36 ASP 36 608 608 ASP ASP A . n A 1 37 CYS 37 609 609 CYS CYS A . n A 1 38 ASN 38 610 610 ASN ASN A . n A 1 39 CYS 39 611 611 CYS CYS A . n A 1 40 LYS 40 612 612 LYS LYS A . n A 1 41 ILE 41 613 613 ILE ILE A . n A 1 42 GLU 42 614 614 GLU GLU A . n A 1 43 ASP 43 615 615 ASP ASP A . n A 1 44 ASN 44 616 616 ASN ASN A . n A 1 45 ARG 45 617 617 ARG ARG A . n A 1 46 LEU 46 618 618 LEU LEU A . n A 1 47 SER 47 619 619 SER SER A . n A 1 48 ARG 48 620 620 ARG ARG A . n A 1 49 VAL 49 621 621 VAL VAL A . n A 1 50 HIS 50 622 622 HIS HIS A . n A 1 51 CYS 51 623 623 CYS CYS A . n A 1 52 PHE 52 624 624 PHE PHE A . n A 1 53 ILE 53 625 625 ILE ILE A . n A 1 54 PHE 54 626 626 PHE PHE A . n A 1 55 LYS 55 627 627 LYS LYS A . n A 1 56 LYS 56 628 628 LYS LYS A . n A 1 57 ARG 57 629 629 ARG ARG A . n A 1 58 HIS 58 630 630 HIS HIS A . n A 1 59 ALA 59 631 631 ALA ALA A . n A 1 60 VAL 60 632 632 VAL VAL A . n A 1 61 GLY 61 633 633 GLY GLY A . n A 1 62 LYS 62 634 634 LYS LYS A . n A 1 63 SER 63 635 635 SER SER A . n A 1 64 MET 64 636 636 MET MET A . n A 1 65 TYR 65 637 637 TYR TYR A . n A 1 66 GLU 66 638 638 GLU GLU A . n A 1 67 SER 67 639 639 SER SER A . n A 1 68 PRO 68 640 640 PRO PRO A . n A 1 69 ALA 69 641 641 ALA ALA A . n A 1 70 GLN 70 642 642 GLN GLN A . n A 1 71 GLY 71 643 643 GLY GLY A . n A 1 72 LEU 72 644 644 LEU LEU A . n A 1 73 ASP 73 645 645 ASP ASP A . n A 1 74 ASP 74 646 646 ASP ASP A . n A 1 75 ILE 75 647 647 ILE ILE A . n A 1 76 TRP 76 648 648 TRP TRP A . n A 1 77 TYR 77 649 649 TYR TYR A . n A 1 78 CYS 78 650 650 CYS CYS A . n A 1 79 HIS 79 651 651 HIS HIS A . n A 1 80 THR 80 652 652 THR THR A . n A 1 81 GLY 81 653 653 GLY GLY A . n A 1 82 THR 82 654 654 THR THR A . n A 1 83 ASN 83 655 655 ASN ASN A . n A 1 84 VAL 84 656 656 VAL VAL A . n A 1 85 SER 85 657 657 SER SER A . n A 1 86 TYR 86 658 658 TYR TYR A . n A 1 87 LEU 87 659 659 LEU LEU A . n A 1 88 ASN 88 660 660 ASN ASN A . n A 1 89 ASN 89 661 661 ASN ASN A . n A 1 90 ASN 90 662 662 ASN ASN A . n A 1 91 ARG 91 663 663 ARG ARG A . n A 1 92 MET 92 664 664 MET MET A . n A 1 93 ILE 93 665 665 ILE ILE A . n A 1 94 GLN 94 666 666 GLN GLN A . n A 1 95 GLY 95 667 667 GLY GLY A . n A 1 96 THR 96 668 668 THR THR A . n A 1 97 LYS 97 669 669 LYS LYS A . n A 1 98 PHE 98 670 670 PHE PHE A . n A 1 99 LEU 99 671 671 LEU LEU A . n A 1 100 LEU 100 672 672 LEU LEU A . n A 1 101 GLN 101 673 673 GLN GLN A . n A 1 102 ASP 102 674 674 ASP ASP A . n A 1 103 GLY 103 675 675 GLY GLY A . n A 1 104 ASP 104 676 676 ASP ASP A . n A 1 105 GLU 105 677 677 GLU GLU A . n A 1 106 ILE 106 678 678 ILE ILE A . n A 1 107 LYS 107 679 679 LYS LYS A . n A 1 108 ILE 108 680 680 ILE ILE A . n A 1 109 ILE 109 681 681 ILE ILE A . n A 1 110 TRP 110 682 682 TRP TRP A . n A 1 111 ASP 111 683 683 ASP ASP A . n A 1 112 LYS 112 684 684 LYS LYS A . n A 1 113 ASN 113 685 685 ASN ASN A . n A 1 114 ASN 114 686 686 ASN ASN A . n A 1 115 LYS 115 687 687 LYS LYS A . n A 1 116 PHE 116 688 688 PHE PHE A . n A 1 117 VAL 117 689 689 VAL VAL A . n A 1 118 ILE 118 690 690 ILE ILE A . n A 1 119 GLY 119 691 691 GLY GLY A . n A 1 120 PHE 120 692 692 PHE PHE A . n A 1 121 LYS 121 693 693 LYS LYS A . n A 1 122 VAL 122 694 694 VAL VAL A . n A 1 123 GLU 123 695 695 GLU GLU A . n A 1 124 ILE 124 696 696 ILE ILE A . n A 1 125 ASN 125 697 697 ASN ASN A . n A 1 126 ASP 126 698 698 ASP ASP A . n A 1 127 THR 127 699 699 THR THR A . n A 1 128 THR 128 700 700 THR THR A . n A 1 129 GLY 129 701 701 GLY GLY A . n A 1 130 LEU 130 702 702 LEU LEU A . n A 1 131 PHE 131 703 703 PHE PHE A . n A 1 132 ASN 132 704 704 ASN ASN A . n A 1 133 GLU 133 705 705 GLU GLU A . n A 1 134 GLY 134 706 706 GLY GLY A . n A 1 135 LEU 135 707 707 LEU LEU A . n A 1 136 GLY 136 708 708 GLY GLY A . n A 1 137 MET 137 709 709 MET MET A . n A 1 138 LEU 138 710 710 LEU LEU A . n A 1 139 GLN 139 711 711 GLN GLN A . n A 1 140 GLU 140 712 712 GLU GLU A . n A 1 141 GLN 141 713 713 GLN GLN A . n A 1 142 ARG 142 714 714 ARG ARG A . n A 1 143 VAL 143 715 715 VAL VAL A . n A 1 144 VAL 144 716 716 VAL VAL A . n A 1 145 LEU 145 717 717 LEU LEU A . n A 1 146 LYS 146 718 718 LYS LYS A . n A 1 147 GLN 147 719 719 GLN GLN A . n A 1 148 THR 148 720 720 THR THR A . n A 1 149 ALA 149 721 721 ALA ALA A . n A 1 150 GLU 150 722 722 GLU GLU A . n A 1 151 GLU 151 723 723 GLU GLU A . n A 1 152 LYS 152 724 724 LYS LYS A . n A 1 153 ASP 153 725 725 ASP ASP A . n A 1 154 LEU 154 726 726 LEU LEU A . n A 1 155 VAL 155 727 727 VAL VAL A . n A 1 156 LYS 156 728 728 LYS LYS A . n A 1 157 LYS 157 729 729 LYS LYS A . n A 1 158 LEU 158 730 730 LEU LEU A . n B 2 1 GLU 1 826 826 GLU GLU P . n B 2 2 ASP 2 827 827 ASP ASP P . n B 2 3 ILE 3 828 828 ILE ILE P . n B 2 4 PTR 4 829 829 PTR PTR P . n B 2 5 TYR 5 830 830 TYR TYR P . n B 2 6 LEU 6 831 831 LEU LEU P . n B 2 7 ASP 7 832 832 ASP ASP P . n # _cell.entry_id 1K2M _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _exptl.entry_id 1K2M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1K2M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1K2M _struct.title 'Solution Structure of the FHA2 Domain of Rad53 Complexed with a Phosphotyrosyl Peptide Derived from Rad9' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K2M _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'FHA domain, Rad53, Rad9, Phosphotyrosine, phosphoprotein, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP RAD53_YEAST 1 ;GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHT GTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL ; 573 P22216 ? 2 UNP RAD9_YEAST 2 EDIYYLD 826 P14737 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1K2M A 1 ? 158 ? P22216 573 ? 730 ? 573 730 2 2 1K2M P 1 ? 7 ? P14737 826 ? 832 ? 826 832 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1K2M _struct_ref_seq_dif.mon_id PTR _struct_ref_seq_dif.pdbx_pdb_strand_id P _struct_ref_seq_dif.seq_num 4 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P14737 _struct_ref_seq_dif.db_mon_id TYR _struct_ref_seq_dif.pdbx_seq_db_seq_num 829 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 829 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 148 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 157 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 720 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 729 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ILE 3 C ? ? ? 1_555 B PTR 4 N ? ? P ILE 828 P PTR 829 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? B PTR 4 C ? ? ? 1_555 B TYR 5 N ? ? P PTR 829 P TYR 830 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id PTR _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 4 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id PTR _pdbx_modification_feature.auth_asym_id P _pdbx_modification_feature.auth_seq_id 829 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id TYR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id PTR _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 1 -0.16 2 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 2 0.22 3 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 3 -0.36 4 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 4 -0.36 5 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 5 -0.34 6 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 6 -0.71 7 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 7 -0.18 8 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 8 0.23 9 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 9 -0.23 10 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 10 -0.02 11 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 11 -0.76 12 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 12 -0.34 13 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 13 -0.27 14 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 14 -0.05 15 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 15 -0.07 16 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 16 -0.35 17 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 17 0.33 18 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 18 0.21 19 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 19 0.21 20 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 20 -0.43 21 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 21 -0.53 22 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 22 0.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 20 ? ILE A 22 ? LEU A 592 ILE A 594 A 2 LEU A 6 ? PRO A 10 ? LEU A 578 PRO A 582 A 3 PHE A 120 ? ILE A 124 ? PHE A 692 ILE A 696 A 4 ASP A 104 ? LYS A 107 ? ASP A 676 LYS A 679 A 5 SER A 85 ? LEU A 87 ? SER A 657 LEU A 659 A 6 ASN A 90 ? MET A 92 ? ASN A 662 MET A 664 B 1 CYS A 39 ? LYS A 40 ? CYS A 611 LYS A 612 B 2 PHE A 29 ? GLY A 32 ? PHE A 601 GLY A 604 B 3 CYS A 51 ? HIS A 58 ? CYS A 623 HIS A 630 B 4 LEU A 72 ? HIS A 79 ? LEU A 644 HIS A 651 B 5 THR A 96 ? LEU A 100 ? THR A 668 LEU A 672 B 6 LEU A 145 ? LYS A 146 ? LEU A 717 LYS A 718 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 20 ? O LEU A 592 N LEU A 8 ? N LEU A 580 A 2 3 N THR A 7 ? N THR A 579 O GLU A 123 ? O GLU A 695 A 3 4 O VAL A 122 ? O VAL A 694 N ASP A 104 ? N ASP A 676 A 4 5 O LYS A 107 ? O LYS A 679 N TYR A 86 ? N TYR A 658 A 5 6 N LEU A 87 ? N LEU A 659 O ASN A 90 ? O ASN A 662 B 1 2 O CYS A 39 ? O CYS A 611 N GLY A 32 ? N GLY A 604 B 2 3 N PHE A 29 ? N PHE A 601 O ILE A 53 ? O ILE A 625 B 3 4 N LYS A 56 ? N LYS A 628 O ASP A 74 ? O ASP A 646 B 4 5 N TYR A 77 ? N TYR A 649 O PHE A 98 ? O PHE A 670 B 5 6 N LYS A 97 ? N LYS A 669 O LEU A 145 ? O LEU A 717 # _pdbx_entry_details.entry_id 1K2M _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 652 ? ? HE21 A GLN 666 ? ? 1.49 2 1 O A TYR 658 ? ? H A LYS 679 ? ? 1.53 3 1 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.53 4 1 O A LYS 628 ? ? H A ASP 646 ? ? 1.55 5 1 H A PHE 626 ? ? O A TRP 648 ? ? 1.57 6 1 H A ILE 587 ? ? O A VAL 689 ? ? 1.58 7 1 O A PHE 602 ? ? H A CYS 611 ? ? 1.58 8 1 O A PHE 626 ? ? H A TRP 648 ? ? 1.59 9 2 O A LYS 628 ? ? H A ASP 646 ? ? 1.49 10 2 O A PHE 624 ? ? H A CYS 650 ? ? 1.49 11 2 H A TYR 658 ? ? O A LYS 679 ? ? 1.56 12 2 O A THR 579 ? ? H A GLU 695 ? ? 1.56 13 2 O A THR 652 ? ? HE21 A GLN 666 ? ? 1.56 14 2 H A PHE 624 ? ? O A CYS 650 ? ? 1.56 15 2 O A GLN 595 ? ? H A VAL 598 ? ? 1.58 16 2 H A TYR 649 ? ? O A PHE 670 ? ? 1.58 17 2 O A LEU 580 ? ? H A LEU 592 ? ? 1.59 18 2 O A TYR 658 ? ? H A LYS 679 ? ? 1.59 19 2 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.59 20 3 O A TYR 658 ? ? H A LYS 679 ? ? 1.52 21 3 H A TYR 658 ? ? O A LYS 679 ? ? 1.52 22 3 H A TYR 649 ? ? O A PHE 670 ? ? 1.52 23 3 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.53 24 3 H A PHE 626 ? ? O A TRP 648 ? ? 1.54 25 3 O A LYS 628 ? ? H A ASP 646 ? ? 1.55 26 3 O A PHE 602 ? ? H A CYS 611 ? ? 1.59 27 3 O A PHE 626 ? ? H A TRP 648 ? ? 1.59 28 3 O A GLN 595 ? ? H A VAL 598 ? ? 1.60 29 4 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.45 30 4 H A TYR 658 ? ? O A LYS 679 ? ? 1.48 31 4 O A LYS 628 ? ? H A ASP 646 ? ? 1.51 32 4 H A TYR 649 ? ? O A PHE 670 ? ? 1.54 33 4 O A ASP 676 ? ? H A VAL 694 ? ? 1.55 34 4 O A HIS 651 ? ? H A GLY 667 ? ? 1.56 35 4 O A PHE 602 ? ? H A CYS 611 ? ? 1.58 36 4 O A THR 652 ? ? HE21 A GLN 666 ? ? 1.59 37 4 H A PHE 626 ? ? O A TRP 648 ? ? 1.59 38 4 H A ILE 603 ? ? O A CYS 623 ? ? 1.59 39 4 O A GLN 595 ? ? H A VAL 598 ? ? 1.60 40 5 O A LYS 628 ? ? H A ASP 646 ? ? 1.51 41 5 O A GLN 595 ? ? H A VAL 598 ? ? 1.56 42 5 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.57 43 5 H A HIS 630 ? ? O A LEU 644 ? ? 1.57 44 5 O A HIS 651 ? ? H A GLY 667 ? ? 1.57 45 5 O A TYR 658 ? ? H A LYS 679 ? ? 1.58 46 5 H A LYS 669 ? ? O A LEU 717 ? ? 1.58 47 5 H A PHE 626 ? ? O A TRP 648 ? ? 1.58 48 5 O A LEU 580 ? ? H A LEU 592 ? ? 1.59 49 5 H A TYR 658 ? ? O A LYS 679 ? ? 1.60 50 6 H A TYR 649 ? ? O A PHE 670 ? ? 1.52 51 6 O A PHE 703 ? ? H A GLU 705 ? ? 1.54 52 6 O A TYR 658 ? ? H A LYS 679 ? ? 1.54 53 6 O A LYS 628 ? ? H A ASP 646 ? ? 1.55 54 6 H A TYR 658 ? ? O A LYS 679 ? ? 1.56 55 6 O A THR 579 ? ? H A GLU 695 ? ? 1.60 56 7 H A TYR 658 ? ? O A LYS 679 ? ? 1.45 57 7 O A LYS 628 ? ? H A ASP 646 ? ? 1.49 58 7 H A PHE 626 ? ? O A TRP 648 ? ? 1.54 59 7 O A VAL 621 ? ? HG1 A THR 652 ? ? 1.57 60 7 O A LEU 578 ? ? H A ILE 594 ? ? 1.57 61 7 O A PHE 626 ? ? H A TRP 648 ? ? 1.58 62 7 H A ILE 603 ? ? O A CYS 623 ? ? 1.58 63 7 O A ASP 676 ? ? H A VAL 694 ? ? 1.59 64 8 O A LYS 628 ? ? H A ASP 646 ? ? 1.48 65 8 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.50 66 8 H A TYR 649 ? ? O A PHE 670 ? ? 1.54 67 8 H A TYR 658 ? ? O A LYS 679 ? ? 1.55 68 8 O A TYR 658 ? ? H A LYS 679 ? ? 1.55 69 8 O A GLN 595 ? ? H A VAL 598 ? ? 1.57 70 8 H A PHE 626 ? ? O A TRP 648 ? ? 1.58 71 9 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.47 72 9 O A LYS 628 ? ? H A ASP 646 ? ? 1.48 73 9 O A TYR 658 ? ? H A LYS 679 ? ? 1.53 74 9 H A TYR 658 ? ? O A LYS 679 ? ? 1.57 75 9 O A ASP 676 ? ? H A VAL 694 ? ? 1.58 76 9 O A ILE 681 ? ? H A ILE 690 ? ? 1.59 77 9 O A PHE 626 ? ? H A TRP 648 ? ? 1.59 78 10 H A TYR 658 ? ? O A LYS 679 ? ? 1.52 79 10 O A TYR 658 ? ? H A LYS 679 ? ? 1.53 80 10 O A LYS 628 ? ? H A ASP 646 ? ? 1.54 81 10 O A GLN 595 ? ? H A VAL 598 ? ? 1.55 82 10 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.55 83 10 O A PHE 703 ? ? H A GLU 705 ? ? 1.56 84 10 O A PHE 602 ? ? H A CYS 611 ? ? 1.59 85 10 H A PHE 626 ? ? O A TRP 648 ? ? 1.60 86 10 O A PHE 703 ? ? N A GLU 705 ? ? 2.17 87 11 O A LYS 628 ? ? H A ASP 646 ? ? 1.53 88 11 H A PHE 626 ? ? O A TRP 648 ? ? 1.55 89 11 H A ILE 603 ? ? O A CYS 623 ? ? 1.56 90 11 H A TYR 649 ? ? O A PHE 670 ? ? 1.57 91 11 O A GLN 595 ? ? H A VAL 598 ? ? 1.58 92 11 O A LEU 580 ? ? H A LEU 592 ? ? 1.58 93 11 O A PHE 601 ? ? H A ILE 625 ? ? 1.59 94 12 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.47 95 12 O A TYR 658 ? ? H A LYS 679 ? ? 1.50 96 12 O A LYS 628 ? ? H A ASP 646 ? ? 1.51 97 12 H A TYR 658 ? ? O A LYS 679 ? ? 1.55 98 12 H A LEU 580 ? ? O A LEU 592 ? ? 1.55 99 12 O A ASP 676 ? ? H A VAL 694 ? ? 1.57 100 13 O A THR 652 ? ? HE21 A GLN 666 ? ? 1.50 101 13 O A LYS 628 ? ? H A ASP 646 ? ? 1.51 102 13 H A PHE 626 ? ? O A TRP 648 ? ? 1.55 103 13 O A HIS 651 ? ? H A GLY 667 ? ? 1.55 104 13 O A TYR 658 ? ? H A LYS 679 ? ? 1.58 105 13 H A SER 657 ? ? O A MET 664 ? ? 1.58 106 13 O A ASP 676 ? ? H A VAL 694 ? ? 1.58 107 13 H A LYS 669 ? ? O A LEU 717 ? ? 1.58 108 13 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.58 109 13 H A TYR 658 ? ? O A LYS 679 ? ? 1.59 110 14 O A TYR 658 ? ? H A LYS 679 ? ? 1.52 111 14 H A TYR 658 ? ? O A LYS 679 ? ? 1.54 112 14 O A PHE 626 ? ? H A TRP 648 ? ? 1.55 113 14 O A LYS 628 ? ? H A ASP 646 ? ? 1.57 114 14 O A LEU 580 ? ? H A LEU 592 ? ? 1.60 115 15 O A LYS 628 ? ? H A ASP 646 ? ? 1.50 116 15 H A TYR 649 ? ? O A PHE 670 ? ? 1.52 117 15 O A HIS 651 ? ? H A GLY 667 ? ? 1.55 118 15 O A TYR 658 ? ? H A LYS 679 ? ? 1.55 119 15 H A PHE 626 ? ? O A TRP 648 ? ? 1.56 120 15 H A TYR 658 ? ? O A LYS 679 ? ? 1.59 121 16 O A LYS 628 ? ? H A ASP 646 ? ? 1.53 122 16 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.56 123 16 O A LEU 580 ? ? H A LEU 592 ? ? 1.59 124 16 O A PHE 626 ? ? H A TRP 648 ? ? 1.59 125 16 O A ASP 676 ? ? H A VAL 694 ? ? 1.60 126 16 H A ILE 603 ? ? O A CYS 623 ? ? 1.60 127 16 H A PHE 626 ? ? O A TRP 648 ? ? 1.60 128 17 O A TYR 658 ? ? H A LYS 679 ? ? 1.48 129 17 O A PHE 703 ? ? H A GLU 705 ? ? 1.52 130 17 O A LYS 628 ? ? H A ASP 646 ? ? 1.53 131 17 H A PHE 626 ? ? O A TRP 648 ? ? 1.55 132 17 O A HIS 651 ? ? H A GLY 667 ? ? 1.58 133 18 O A LYS 628 ? ? H A ASP 646 ? ? 1.53 134 18 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.55 135 18 O A ASP 676 ? ? H A VAL 694 ? ? 1.56 136 18 O A TYR 658 ? ? H A LYS 679 ? ? 1.57 137 18 O A VAL 621 ? ? HG1 A THR 652 ? ? 1.57 138 18 O A PHE 602 ? ? H A CYS 611 ? ? 1.58 139 18 O A PHE 626 ? ? H A TRP 648 ? ? 1.60 140 19 O A GLN 595 ? ? H A VAL 598 ? ? 1.40 141 19 O A PHE 624 ? ? H A CYS 650 ? ? 1.48 142 19 O A LYS 628 ? ? H A ASP 646 ? ? 1.51 143 19 O A TYR 658 ? ? H A LYS 679 ? ? 1.53 144 19 O A THR 652 ? ? HE21 A GLN 666 ? ? 1.58 145 19 O A ASP 676 ? ? H A VAL 694 ? ? 1.59 146 19 H A TYR 658 ? ? O A LYS 679 ? ? 1.59 147 19 H A TYR 649 ? ? O A PHE 670 ? ? 1.59 148 19 O A LEU 580 ? ? H A LEU 592 ? ? 1.60 149 19 O A HIS 651 ? ? H A GLY 667 ? ? 1.60 150 19 H A PHE 624 ? ? O A CYS 650 ? ? 1.60 151 20 H A PHE 626 ? ? O A TRP 648 ? ? 1.50 152 20 H A TYR 658 ? ? O A LYS 679 ? ? 1.51 153 20 H A TYR 649 ? ? O A PHE 670 ? ? 1.52 154 20 O A ILE 681 ? ? H A ILE 690 ? ? 1.55 155 20 O A LYS 628 ? ? H A ASP 646 ? ? 1.55 156 20 O A TYR 658 ? ? H A LYS 679 ? ? 1.59 157 21 H A TYR 658 ? ? O A LYS 679 ? ? 1.49 158 21 O A LYS 628 ? ? H A ASP 646 ? ? 1.49 159 21 O A TYR 658 ? ? H A LYS 679 ? ? 1.50 160 21 O A LEU 580 ? ? H A LEU 592 ? ? 1.58 161 21 O A PHE 626 ? ? H A TRP 648 ? ? 1.59 162 22 H A PHE 626 ? ? O A TRP 648 ? ? 1.56 163 22 O A LYS 628 ? ? H A ASP 646 ? ? 1.57 164 22 O A PHE 626 ? ? H A TRP 648 ? ? 1.58 165 22 O A PHE 602 ? ? H A CYS 611 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 577 ? ? -127.12 -61.08 2 1 PRO A 582 ? ? -46.86 100.02 3 1 ASN A 616 ? ? -38.80 -30.81 4 1 TYR A 637 ? ? 71.86 -63.78 5 1 GLN A 642 ? ? 62.33 -82.53 6 1 LEU A 644 ? ? -99.83 -157.56 7 1 VAL A 656 ? ? 51.59 133.02 8 1 ASN A 660 ? ? 60.11 -81.32 9 1 GLN A 666 ? ? -55.81 104.00 10 1 ASP A 674 ? ? -37.01 120.52 11 1 LYS A 687 ? ? 59.93 19.29 12 1 PHE A 703 ? ? -33.84 -36.77 13 1 ASN A 704 ? ? -171.98 30.53 14 1 GLU A 705 ? ? 68.31 -57.93 15 1 LEU A 710 ? ? -58.86 -161.70 16 1 GLN A 711 ? ? 77.22 -64.17 17 1 ARG A 714 ? ? 19.96 85.51 18 1 TYR P 830 ? ? -175.82 89.65 19 2 PHE A 577 ? ? -128.82 -56.23 20 2 PRO A 582 ? ? -45.96 101.11 21 2 GLN A 589 ? ? -104.05 57.09 22 2 VAL A 621 ? ? -105.18 53.05 23 2 TYR A 637 ? ? 66.85 -70.47 24 2 PRO A 640 ? ? -70.71 -163.36 25 2 GLN A 642 ? ? 70.55 -67.50 26 2 LEU A 644 ? ? -101.14 -157.56 27 2 VAL A 656 ? ? 54.32 128.42 28 2 ASN A 660 ? ? 59.43 -83.83 29 2 THR A 700 ? ? -91.08 50.74 30 2 ASN A 704 ? ? -147.88 -44.69 31 2 GLU A 705 ? ? 136.10 -34.00 32 2 ARG A 714 ? ? 42.43 86.90 33 2 LYS A 729 ? ? -102.08 -63.20 34 3 PHE A 577 ? ? -132.69 -47.28 35 3 PRO A 582 ? ? -47.66 99.22 36 3 GLN A 589 ? ? -106.03 55.73 37 3 LYS A 634 ? ? 60.07 105.15 38 3 TYR A 637 ? ? 67.43 -74.66 39 3 PRO A 640 ? ? -65.01 -149.98 40 3 GLN A 642 ? ? 71.95 -171.92 41 3 LEU A 644 ? ? -107.67 -156.53 42 3 VAL A 656 ? ? 50.14 136.71 43 3 ASN A 660 ? ? 60.76 -81.51 44 3 GLN A 666 ? ? -42.76 107.10 45 3 ASP A 674 ? ? -65.61 95.18 46 3 ASN A 704 ? ? -148.40 -56.06 47 3 GLU A 705 ? ? 156.14 -28.76 48 3 LEU A 710 ? ? -55.27 -162.85 49 3 ARG A 714 ? ? 40.26 83.48 50 3 ASP P 827 ? ? 62.11 78.71 51 3 ILE P 828 ? ? -99.36 37.07 52 3 TYR P 830 ? ? -177.25 137.50 53 4 PHE A 577 ? ? -132.96 -51.88 54 4 PRO A 582 ? ? -49.67 106.86 55 4 GLN A 589 ? ? -116.71 59.64 56 4 VAL A 621 ? ? -110.08 62.89 57 4 ALA A 631 ? ? 176.42 126.70 58 4 LYS A 634 ? ? 61.85 152.34 59 4 SER A 635 ? ? -95.42 44.48 60 4 TYR A 637 ? ? 70.57 -62.74 61 4 PRO A 640 ? ? -66.95 -150.22 62 4 ALA A 641 ? ? -92.35 36.01 63 4 GLN A 642 ? ? 67.90 -70.25 64 4 LEU A 644 ? ? -93.95 -159.57 65 4 VAL A 656 ? ? 60.21 146.10 66 4 ASN A 660 ? ? 60.24 -84.54 67 4 ASP A 674 ? ? -40.52 108.82 68 4 ASN A 704 ? ? -147.98 -61.25 69 4 GLU A 705 ? ? 145.36 33.47 70 4 MET A 709 ? ? 165.22 111.12 71 4 LEU A 710 ? ? 59.36 -161.18 72 4 GLN A 711 ? ? -46.03 -94.59 73 4 ARG A 714 ? ? 160.37 69.77 74 4 TYR P 830 ? ? -178.48 126.61 75 5 PRO A 582 ? ? -46.84 99.00 76 5 GLN A 589 ? ? -113.99 56.43 77 5 VAL A 621 ? ? -112.66 57.85 78 5 TYR A 637 ? ? 68.74 -71.09 79 5 ALA A 641 ? ? 70.68 -62.73 80 5 GLN A 642 ? ? 64.24 170.07 81 5 LEU A 644 ? ? -102.78 -153.46 82 5 VAL A 656 ? ? 52.42 127.01 83 5 ASN A 660 ? ? 60.91 -81.67 84 5 ASP A 674 ? ? -58.37 104.33 85 5 THR A 700 ? ? -69.79 65.34 86 5 ASN A 704 ? ? -160.13 -51.62 87 5 GLU A 705 ? ? 159.53 -31.95 88 5 MET A 709 ? ? 35.79 40.48 89 5 ARG A 714 ? ? 39.90 84.33 90 6 PRO A 582 ? ? -47.22 103.62 91 6 GLN A 589 ? ? -109.10 61.66 92 6 VAL A 621 ? ? -113.87 62.63 93 6 LYS A 634 ? ? 60.31 177.85 94 6 TYR A 637 ? ? 69.26 -66.47 95 6 PRO A 640 ? ? -60.04 -151.41 96 6 GLN A 642 ? ? 82.34 -71.06 97 6 LEU A 644 ? ? -106.93 -154.26 98 6 VAL A 656 ? ? 49.48 137.97 99 6 ASN A 660 ? ? 60.51 -81.94 100 6 GLN A 666 ? ? -55.30 108.06 101 6 ASP A 674 ? ? -45.90 104.04 102 6 LYS A 687 ? ? 58.78 19.04 103 6 LEU A 702 ? ? -97.10 32.90 104 6 PHE A 703 ? ? 61.55 109.10 105 6 ASN A 704 ? ? 56.14 -69.64 106 6 GLU A 705 ? ? 172.24 -22.72 107 6 ARG A 714 ? ? 39.85 87.58 108 6 TYR P 830 ? ? -177.84 -178.13 109 7 PHE A 577 ? ? -128.07 -62.93 110 7 PRO A 582 ? ? -47.47 97.43 111 7 GLN A 589 ? ? -111.46 57.09 112 7 VAL A 621 ? ? -115.67 63.08 113 7 TYR A 637 ? ? 72.60 -62.53 114 7 GLN A 642 ? ? 64.38 -165.57 115 7 LEU A 644 ? ? -114.68 -156.69 116 7 VAL A 656 ? ? 67.59 146.17 117 7 ASN A 660 ? ? 62.46 -82.11 118 7 GLN A 666 ? ? -47.50 107.36 119 7 GLU A 705 ? ? 87.69 -41.44 120 7 MET A 709 ? ? -48.79 96.02 121 7 LEU A 710 ? ? 67.32 158.79 122 7 GLN A 711 ? ? -68.60 65.46 123 7 ARG A 714 ? ? -87.87 -143.30 124 7 ASP P 827 ? ? -176.57 119.21 125 7 TYR P 830 ? ? -172.35 123.80 126 8 PHE A 577 ? ? -131.30 -60.88 127 8 PRO A 582 ? ? -46.07 99.13 128 8 TYR A 637 ? ? 69.24 -66.72 129 8 PRO A 640 ? ? -72.07 -162.10 130 8 GLN A 642 ? ? 82.81 -64.75 131 8 LEU A 644 ? ? -88.78 -155.84 132 8 VAL A 656 ? ? 50.40 130.66 133 8 ASN A 660 ? ? 61.31 -81.23 134 8 ASP A 674 ? ? -46.76 105.25 135 8 ASN A 704 ? ? -155.99 -53.56 136 8 GLU A 705 ? ? 161.47 -26.84 137 8 MET A 709 ? ? -94.34 43.62 138 8 ARG A 714 ? ? 41.68 87.31 139 9 PHE A 577 ? ? -124.22 -63.57 140 9 PRO A 582 ? ? -47.11 105.13 141 9 GLN A 589 ? ? -117.57 52.98 142 9 ASN A 616 ? ? -37.83 -30.02 143 9 VAL A 632 ? ? -60.02 -176.77 144 9 SER A 635 ? ? -171.72 135.91 145 9 TYR A 637 ? ? 66.51 -72.85 146 9 PRO A 640 ? ? -61.37 -149.61 147 9 GLN A 642 ? ? -52.45 102.00 148 9 VAL A 656 ? ? 52.46 130.55 149 9 ASN A 660 ? ? 61.57 -80.91 150 9 GLN A 666 ? ? -47.34 108.64 151 9 ASP A 674 ? ? -39.04 123.33 152 9 GLU A 705 ? ? 88.68 -42.03 153 9 MET A 709 ? ? -49.03 94.60 154 9 LEU A 710 ? ? 34.61 88.81 155 9 ASP P 827 ? ? 62.05 149.24 156 10 PRO A 582 ? ? -45.80 99.90 157 10 LYS A 634 ? ? -171.74 112.79 158 10 SER A 635 ? ? -63.79 92.47 159 10 TYR A 637 ? ? 70.11 -64.29 160 10 PRO A 640 ? ? -84.13 -159.11 161 10 GLN A 642 ? ? 69.26 -78.70 162 10 LEU A 644 ? ? -116.89 -153.22 163 10 VAL A 656 ? ? 51.94 128.43 164 10 ASN A 660 ? ? 61.14 -83.73 165 10 GLN A 666 ? ? -46.76 106.15 166 10 THR A 700 ? ? -68.02 62.41 167 10 ASN A 704 ? ? 51.39 -71.90 168 10 GLU A 705 ? ? 163.02 -43.63 169 10 MET A 709 ? ? 59.01 120.40 170 10 LEU A 710 ? ? 176.86 157.98 171 10 ARG A 714 ? ? 41.83 81.74 172 10 ASP P 827 ? ? -165.43 103.28 173 10 TYR P 830 ? ? -179.33 132.91 174 11 PRO A 582 ? ? -48.45 96.70 175 11 GLN A 589 ? ? -114.85 51.81 176 11 VAL A 621 ? ? -113.06 62.38 177 11 LYS A 634 ? ? 63.28 133.55 178 11 TYR A 637 ? ? 67.28 -73.78 179 11 GLN A 642 ? ? 63.23 -82.03 180 11 LEU A 644 ? ? -103.82 -158.52 181 11 VAL A 656 ? ? 63.95 143.67 182 11 ASN A 660 ? ? 61.82 -81.96 183 11 GLN A 666 ? ? -47.43 103.82 184 11 ASP A 674 ? ? -58.30 108.83 185 11 ASN A 704 ? ? -151.50 -51.88 186 11 GLU A 705 ? ? 160.46 -30.87 187 11 MET A 709 ? ? 59.46 99.25 188 11 LEU A 710 ? ? 179.02 -177.88 189 11 ARG A 714 ? ? 47.10 76.26 190 11 LYS A 729 ? ? -97.86 33.10 191 11 ASP P 827 ? ? -170.20 135.90 192 11 TYR P 830 ? ? -176.19 142.30 193 12 PHE A 577 ? ? -123.59 -58.91 194 12 PRO A 582 ? ? -45.22 103.87 195 12 GLN A 589 ? ? -108.14 69.29 196 12 SER A 635 ? ? -146.76 54.82 197 12 TYR A 637 ? ? 68.97 -69.51 198 12 PRO A 640 ? ? -71.18 -154.91 199 12 LEU A 644 ? ? -111.78 -162.43 200 12 VAL A 656 ? ? 53.56 128.49 201 12 ASN A 660 ? ? 60.40 -79.96 202 12 GLN A 666 ? ? -45.73 104.91 203 12 THR A 700 ? ? -69.23 61.47 204 12 ASN A 704 ? ? 43.33 -79.85 205 12 GLU A 705 ? ? 164.77 -48.59 206 12 LEU A 710 ? ? 178.02 -174.70 207 12 ARG A 714 ? ? 40.37 86.52 208 13 PHE A 577 ? ? -124.35 -62.37 209 13 PRO A 582 ? ? -46.98 99.37 210 13 GLN A 589 ? ? -108.24 54.75 211 13 SER A 635 ? ? -169.94 52.76 212 13 MET A 636 ? ? -99.60 31.56 213 13 TYR A 637 ? ? -165.26 -50.81 214 13 GLN A 642 ? ? 60.86 -169.16 215 13 LEU A 644 ? ? -105.30 -153.51 216 13 VAL A 656 ? ? 64.31 146.73 217 13 ASN A 660 ? ? 63.44 -80.17 218 13 ASP A 674 ? ? -37.00 118.98 219 13 ASN A 704 ? ? -146.64 -61.09 220 13 GLU A 705 ? ? 144.97 32.77 221 13 MET A 709 ? ? 61.23 120.87 222 13 LEU A 710 ? ? 178.25 164.24 223 13 ARG A 714 ? ? 40.26 84.64 224 13 ILE P 828 ? ? 65.44 76.07 225 13 TYR P 830 ? ? -179.98 79.84 226 14 PRO A 582 ? ? -47.81 98.19 227 14 GLN A 589 ? ? -116.93 54.62 228 14 ASN A 616 ? ? -39.44 -28.48 229 14 ALA A 631 ? ? -60.27 -158.90 230 14 VAL A 632 ? ? 58.77 125.93 231 14 TYR A 637 ? ? 63.06 -80.43 232 14 PRO A 640 ? ? -59.62 -149.71 233 14 GLN A 642 ? ? 64.26 -176.29 234 14 LEU A 644 ? ? -115.75 -157.37 235 14 VAL A 656 ? ? 50.79 137.11 236 14 ASN A 660 ? ? 60.76 -82.13 237 14 GLN A 666 ? ? -54.92 105.53 238 14 ASP A 674 ? ? -39.11 123.11 239 14 PHE A 703 ? ? -39.76 -32.35 240 14 ASN A 704 ? ? -178.95 33.56 241 14 GLU A 705 ? ? 69.28 -64.08 242 14 LEU A 710 ? ? -58.90 -161.44 243 14 GLN A 711 ? ? 78.46 -60.69 244 14 ARG A 714 ? ? 16.02 82.39 245 14 TYR P 830 ? ? -175.55 143.48 246 15 PHE A 577 ? ? -129.16 -61.15 247 15 PRO A 582 ? ? -48.98 101.77 248 15 GLN A 589 ? ? -106.74 57.32 249 15 ALA A 631 ? ? -69.08 -165.61 250 15 TYR A 637 ? ? 70.11 -62.87 251 15 PRO A 640 ? ? -72.56 -162.94 252 15 GLN A 642 ? ? 67.40 -71.06 253 15 LEU A 644 ? ? -106.14 -159.71 254 15 VAL A 656 ? ? 50.59 127.86 255 15 ASN A 660 ? ? 63.42 -78.53 256 15 ASN A 661 ? ? -140.11 -2.08 257 15 ASP A 674 ? ? -40.96 109.36 258 15 ASN A 704 ? ? -149.86 -55.80 259 15 GLU A 705 ? ? 141.36 31.26 260 15 LEU A 710 ? ? 63.99 -168.41 261 15 GLN A 711 ? ? -52.26 -96.60 262 15 ARG A 714 ? ? 166.69 131.21 263 15 ILE P 828 ? ? -112.02 71.38 264 15 TYR P 830 ? ? -171.56 141.26 265 16 PHE A 577 ? ? -125.69 -57.81 266 16 PRO A 582 ? ? -46.08 104.14 267 16 GLN A 589 ? ? -100.69 71.16 268 16 ARG A 620 ? ? -39.00 -38.60 269 16 LYS A 634 ? ? 63.27 144.57 270 16 MET A 636 ? ? -170.79 118.73 271 16 TYR A 637 ? ? 69.26 -66.85 272 16 PRO A 640 ? ? -71.73 -155.75 273 16 GLN A 642 ? ? 72.04 -78.21 274 16 LEU A 644 ? ? -107.05 -161.71 275 16 VAL A 656 ? ? 50.67 139.97 276 16 ASN A 660 ? ? 62.53 -77.39 277 16 ASN A 704 ? ? -148.39 -58.79 278 16 GLU A 705 ? ? 146.92 28.80 279 16 MET A 709 ? ? 62.57 93.42 280 16 LEU A 710 ? ? 29.51 66.88 281 16 GLN A 711 ? ? 46.81 70.47 282 16 ARG A 714 ? ? -100.30 -148.66 283 16 ASP P 827 ? ? 60.12 167.23 284 16 TYR P 830 ? ? 178.68 67.39 285 17 PRO A 582 ? ? -45.94 99.79 286 17 GLN A 589 ? ? -108.16 57.05 287 17 ASN A 616 ? ? -39.30 -29.57 288 17 SER A 635 ? ? -176.51 110.09 289 17 TYR A 637 ? ? 69.88 -63.99 290 17 PRO A 640 ? ? -59.40 -150.28 291 17 GLN A 642 ? ? 74.60 -77.68 292 17 LEU A 644 ? ? -115.74 -149.32 293 17 VAL A 656 ? ? 50.87 134.20 294 17 ASN A 660 ? ? 59.33 -81.72 295 17 GLN A 666 ? ? -58.77 109.82 296 17 ASP A 674 ? ? -52.76 101.52 297 17 ASN A 704 ? ? 59.73 -68.07 298 17 GLU A 705 ? ? 171.39 -32.67 299 17 LEU A 710 ? ? -177.81 -175.76 300 17 ARG A 714 ? ? 34.80 79.02 301 17 LEU P 831 ? ? -148.75 37.23 302 18 PHE A 577 ? ? -132.61 -47.98 303 18 PRO A 582 ? ? -46.91 101.01 304 18 GLN A 589 ? ? -114.22 58.50 305 18 SER A 635 ? ? -169.64 76.09 306 18 TYR A 637 ? ? 63.21 -80.28 307 18 ALA A 641 ? ? 69.49 -61.07 308 18 GLN A 642 ? ? 74.55 -74.19 309 18 LEU A 644 ? ? -102.47 -166.01 310 18 VAL A 656 ? ? 54.90 128.05 311 18 ASN A 660 ? ? 59.03 -83.96 312 18 GLN A 666 ? ? -44.81 109.32 313 18 ASN A 704 ? ? -159.20 26.60 314 18 GLU A 705 ? ? 71.55 -56.87 315 18 LEU A 710 ? ? -176.10 -170.97 316 18 ARG A 714 ? ? 39.36 86.94 317 18 ASP P 827 ? ? 61.73 73.06 318 18 ILE P 828 ? ? -108.96 75.88 319 18 TYR P 830 ? ? 179.31 150.09 320 19 PHE A 577 ? ? -109.20 -62.29 321 19 PRO A 582 ? ? -45.78 100.79 322 19 GLN A 589 ? ? -119.47 67.74 323 19 GLN A 596 ? ? -29.60 -54.02 324 19 VAL A 621 ? ? -110.76 57.52 325 19 ALA A 631 ? ? -171.40 146.75 326 19 SER A 635 ? ? -67.32 91.05 327 19 TYR A 637 ? ? 78.43 -55.57 328 19 GLN A 642 ? ? 64.48 -164.62 329 19 LEU A 644 ? ? -110.54 -163.25 330 19 VAL A 656 ? ? 51.16 129.29 331 19 ASN A 660 ? ? 60.93 -80.95 332 19 ASN A 704 ? ? -148.10 -61.20 333 19 GLU A 705 ? ? 145.42 32.97 334 19 MET A 709 ? ? 39.36 -147.14 335 19 LEU A 710 ? ? 77.91 162.66 336 19 ARG A 714 ? ? 41.48 89.59 337 19 ASP P 827 ? ? -156.71 63.04 338 20 PHE A 577 ? ? -125.66 -58.30 339 20 PRO A 582 ? ? -44.72 100.71 340 20 VAL A 621 ? ? -116.76 58.09 341 20 SER A 635 ? ? -165.63 78.11 342 20 TYR A 637 ? ? 63.82 -77.49 343 20 ALA A 641 ? ? 70.29 -62.71 344 20 GLN A 642 ? ? 65.05 -173.14 345 20 LEU A 644 ? ? -79.99 -160.84 346 20 VAL A 656 ? ? 51.57 137.75 347 20 ASN A 660 ? ? 61.06 -81.65 348 20 GLN A 666 ? ? -51.41 105.05 349 20 ASP A 674 ? ? -53.20 109.70 350 20 PHE A 703 ? ? 67.85 175.67 351 20 ASN A 704 ? ? -14.56 -62.36 352 20 GLU A 705 ? ? 151.51 -38.16 353 20 LEU A 710 ? ? -173.26 -162.57 354 20 ARG A 714 ? ? 43.38 86.87 355 20 ASP P 827 ? ? 58.72 175.19 356 20 LEU P 831 ? ? -151.74 83.69 357 21 PRO A 582 ? ? -48.15 98.16 358 21 GLN A 589 ? ? -109.34 52.38 359 21 VAL A 621 ? ? -119.71 59.24 360 21 LYS A 634 ? ? -56.86 -173.54 361 21 TYR A 637 ? ? 81.17 -15.88 362 21 PRO A 640 ? ? -35.82 158.71 363 21 ALA A 641 ? ? 176.21 -53.44 364 21 GLN A 642 ? ? 42.26 -91.57 365 21 LEU A 644 ? ? -71.51 -160.82 366 21 VAL A 656 ? ? 50.44 135.37 367 21 ASN A 660 ? ? 59.73 -82.49 368 21 GLN A 666 ? ? -49.12 107.10 369 21 ASN A 704 ? ? -157.56 20.83 370 21 GLU A 705 ? ? 70.98 -57.52 371 21 MET A 709 ? ? 64.33 -147.30 372 21 LEU A 710 ? ? -144.92 -159.61 373 21 GLN A 711 ? ? 69.46 -65.51 374 21 ARG A 714 ? ? 34.88 90.79 375 21 ASP P 827 ? ? 62.46 150.55 376 21 TYR P 830 ? ? 179.80 142.28 377 22 PRO A 582 ? ? -44.53 103.06 378 22 GLN A 589 ? ? -113.67 69.54 379 22 VAL A 621 ? ? -106.10 58.01 380 22 TYR A 637 ? ? 63.63 -78.07 381 22 ALA A 641 ? ? 70.19 -65.07 382 22 GLN A 642 ? ? 65.16 -78.00 383 22 LEU A 644 ? ? -113.87 -156.88 384 22 VAL A 656 ? ? 54.39 123.71 385 22 ASN A 660 ? ? 62.49 -78.91 386 22 GLN A 666 ? ? -47.92 97.22 387 22 ASP A 674 ? ? -57.15 99.45 388 22 THR A 700 ? ? -65.42 66.41 389 22 ASN A 704 ? ? 53.22 -73.93 390 22 GLU A 705 ? ? 176.66 -28.33 391 22 ARG A 714 ? ? 46.49 81.97 392 22 TYR P 830 ? ? -178.64 126.09 393 22 LEU P 831 ? ? -122.74 -169.13 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id P _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 829 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_nmr_ensemble.entry_id 1K2M _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 22 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM FHA2 U-15N,13C; 1mM phosphotyrosyl peptide of Rad9; 10 mM sodium phosphate (pH 6.5), 1 mM DTT, and 1 mM EDTA' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM sodium phosphate(pH 6.5), 1 mM DTT, and 1 mM EDTA' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1K2M _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1K2M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The complex structures are generated using a total of 3398 restraints, 3210 distance restraints, and 188 TOLOS-derived dihedral angle restraints. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 XwinNMR 2.6 processing Bruker 2 X-PLOR 3.851 'structure solution' Brunger 3 X-PLOR 3.851 refinement Brunger 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 PTR N N N N 287 PTR CA C N S 288 PTR C C N N 289 PTR O O N N 290 PTR OXT O N N 291 PTR CB C N N 292 PTR CG C Y N 293 PTR CD1 C Y N 294 PTR CD2 C Y N 295 PTR CE1 C Y N 296 PTR CE2 C Y N 297 PTR CZ C Y N 298 PTR OH O N N 299 PTR P P N N 300 PTR O1P O N N 301 PTR O2P O N N 302 PTR O3P O N N 303 PTR H H N N 304 PTR H2 H N N 305 PTR HA H N N 306 PTR HXT H N N 307 PTR HB2 H N N 308 PTR HB3 H N N 309 PTR HD1 H N N 310 PTR HD2 H N N 311 PTR HE1 H N N 312 PTR HE2 H N N 313 PTR HO2P H N N 314 PTR HO3P H N N 315 SER N N N N 316 SER CA C N S 317 SER C C N N 318 SER O O N N 319 SER CB C N N 320 SER OG O N N 321 SER OXT O N N 322 SER H H N N 323 SER H2 H N N 324 SER HA H N N 325 SER HB2 H N N 326 SER HB3 H N N 327 SER HG H N N 328 SER HXT H N N 329 THR N N N N 330 THR CA C N S 331 THR C C N N 332 THR O O N N 333 THR CB C N R 334 THR OG1 O N N 335 THR CG2 C N N 336 THR OXT O N N 337 THR H H N N 338 THR H2 H N N 339 THR HA H N N 340 THR HB H N N 341 THR HG1 H N N 342 THR HG21 H N N 343 THR HG22 H N N 344 THR HG23 H N N 345 THR HXT H N N 346 TRP N N N N 347 TRP CA C N S 348 TRP C C N N 349 TRP O O N N 350 TRP CB C N N 351 TRP CG C Y N 352 TRP CD1 C Y N 353 TRP CD2 C Y N 354 TRP NE1 N Y N 355 TRP CE2 C Y N 356 TRP CE3 C Y N 357 TRP CZ2 C Y N 358 TRP CZ3 C Y N 359 TRP CH2 C Y N 360 TRP OXT O N N 361 TRP H H N N 362 TRP H2 H N N 363 TRP HA H N N 364 TRP HB2 H N N 365 TRP HB3 H N N 366 TRP HD1 H N N 367 TRP HE1 H N N 368 TRP HE3 H N N 369 TRP HZ2 H N N 370 TRP HZ3 H N N 371 TRP HH2 H N N 372 TRP HXT H N N 373 TYR N N N N 374 TYR CA C N S 375 TYR C C N N 376 TYR O O N N 377 TYR CB C N N 378 TYR CG C Y N 379 TYR CD1 C Y N 380 TYR CD2 C Y N 381 TYR CE1 C Y N 382 TYR CE2 C Y N 383 TYR CZ C Y N 384 TYR OH O N N 385 TYR OXT O N N 386 TYR H H N N 387 TYR H2 H N N 388 TYR HA H N N 389 TYR HB2 H N N 390 TYR HB3 H N N 391 TYR HD1 H N N 392 TYR HD2 H N N 393 TYR HE1 H N N 394 TYR HE2 H N N 395 TYR HH H N N 396 TYR HXT H N N 397 VAL N N N N 398 VAL CA C N S 399 VAL C C N N 400 VAL O O N N 401 VAL CB C N N 402 VAL CG1 C N N 403 VAL CG2 C N N 404 VAL OXT O N N 405 VAL H H N N 406 VAL H2 H N N 407 VAL HA H N N 408 VAL HB H N N 409 VAL HG11 H N N 410 VAL HG12 H N N 411 VAL HG13 H N N 412 VAL HG21 H N N 413 VAL HG22 H N N 414 VAL HG23 H N N 415 VAL HXT H N N 416 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 PTR N CA sing N N 275 PTR N H sing N N 276 PTR N H2 sing N N 277 PTR CA C sing N N 278 PTR CA CB sing N N 279 PTR CA HA sing N N 280 PTR C O doub N N 281 PTR C OXT sing N N 282 PTR OXT HXT sing N N 283 PTR CB CG sing N N 284 PTR CB HB2 sing N N 285 PTR CB HB3 sing N N 286 PTR CG CD1 doub Y N 287 PTR CG CD2 sing Y N 288 PTR CD1 CE1 sing Y N 289 PTR CD1 HD1 sing N N 290 PTR CD2 CE2 doub Y N 291 PTR CD2 HD2 sing N N 292 PTR CE1 CZ doub Y N 293 PTR CE1 HE1 sing N N 294 PTR CE2 CZ sing Y N 295 PTR CE2 HE2 sing N N 296 PTR CZ OH sing N N 297 PTR OH P sing N N 298 PTR P O1P doub N N 299 PTR P O2P sing N N 300 PTR P O3P sing N N 301 PTR O2P HO2P sing N N 302 PTR O3P HO3P sing N N 303 SER N CA sing N N 304 SER N H sing N N 305 SER N H2 sing N N 306 SER CA C sing N N 307 SER CA CB sing N N 308 SER CA HA sing N N 309 SER C O doub N N 310 SER C OXT sing N N 311 SER CB OG sing N N 312 SER CB HB2 sing N N 313 SER CB HB3 sing N N 314 SER OG HG sing N N 315 SER OXT HXT sing N N 316 THR N CA sing N N 317 THR N H sing N N 318 THR N H2 sing N N 319 THR CA C sing N N 320 THR CA CB sing N N 321 THR CA HA sing N N 322 THR C O doub N N 323 THR C OXT sing N N 324 THR CB OG1 sing N N 325 THR CB CG2 sing N N 326 THR CB HB sing N N 327 THR OG1 HG1 sing N N 328 THR CG2 HG21 sing N N 329 THR CG2 HG22 sing N N 330 THR CG2 HG23 sing N N 331 THR OXT HXT sing N N 332 TRP N CA sing N N 333 TRP N H sing N N 334 TRP N H2 sing N N 335 TRP CA C sing N N 336 TRP CA CB sing N N 337 TRP CA HA sing N N 338 TRP C O doub N N 339 TRP C OXT sing N N 340 TRP CB CG sing N N 341 TRP CB HB2 sing N N 342 TRP CB HB3 sing N N 343 TRP CG CD1 doub Y N 344 TRP CG CD2 sing Y N 345 TRP CD1 NE1 sing Y N 346 TRP CD1 HD1 sing N N 347 TRP CD2 CE2 doub Y N 348 TRP CD2 CE3 sing Y N 349 TRP NE1 CE2 sing Y N 350 TRP NE1 HE1 sing N N 351 TRP CE2 CZ2 sing Y N 352 TRP CE3 CZ3 doub Y N 353 TRP CE3 HE3 sing N N 354 TRP CZ2 CH2 doub Y N 355 TRP CZ2 HZ2 sing N N 356 TRP CZ3 CH2 sing Y N 357 TRP CZ3 HZ3 sing N N 358 TRP CH2 HH2 sing N N 359 TRP OXT HXT sing N N 360 TYR N CA sing N N 361 TYR N H sing N N 362 TYR N H2 sing N N 363 TYR CA C sing N N 364 TYR CA CB sing N N 365 TYR CA HA sing N N 366 TYR C O doub N N 367 TYR C OXT sing N N 368 TYR CB CG sing N N 369 TYR CB HB2 sing N N 370 TYR CB HB3 sing N N 371 TYR CG CD1 doub Y N 372 TYR CG CD2 sing Y N 373 TYR CD1 CE1 sing Y N 374 TYR CD1 HD1 sing N N 375 TYR CD2 CE2 doub Y N 376 TYR CD2 HD2 sing N N 377 TYR CE1 CZ doub Y N 378 TYR CE1 HE1 sing N N 379 TYR CE2 CZ sing Y N 380 TYR CE2 HE2 sing N N 381 TYR CZ OH sing N N 382 TYR OH HH sing N N 383 TYR OXT HXT sing N N 384 VAL N CA sing N N 385 VAL N H sing N N 386 VAL N H2 sing N N 387 VAL CA C sing N N 388 VAL CA CB sing N N 389 VAL CA HA sing N N 390 VAL C O doub N N 391 VAL C OXT sing N N 392 VAL CB CG1 sing N N 393 VAL CB CG2 sing N N 394 VAL CB HB sing N N 395 VAL CG1 HG11 sing N N 396 VAL CG1 HG12 sing N N 397 VAL CG1 HG13 sing N N 398 VAL CG2 HG21 sing N N 399 VAL CG2 HG22 sing N N 400 VAL CG2 HG23 sing N N 401 VAL OXT HXT sing N N 402 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1K2M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_