data_1K5R # _entry.id 1K5R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1K5R pdb_00001k5r 10.2210/pdb1k5r/pdb RCSB RCSB014594 ? ? WWPDB D_1000014594 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1JMQ . unspecified PDB 1EOM . unspecified PDB 1EG3 . unspecified PDB 1EG4 . unspecified PDB 1I5H . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K5R _pdbx_database_status.recvd_initial_deposition_date 2001-10-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ferguson, N.' 1 'Pires, J.R.' 2 'Toepert, F.' 3 'Johnson, C.M.' 4 'Pan, Y.P.' 5 'Volkmer-Engert, R.' 6 'Schneider-Mergener, J.' 7 'Daggett, V.' 8 'Oschkinat, H.' 9 'Fersht, A.R.' 10 # _citation.id primary _citation.title 'Using flexible loop mimetics to extend phi-value analysis to secondary structure interactions.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 98 _citation.page_first 13008 _citation.page_last 13013 _citation.year 2001 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11687614 _citation.pdbx_database_id_DOI 10.1073/pnas.221467398 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ferguson, N.' 1 ? primary 'Pires, J.R.' 2 ? primary 'Toepert, F.' 3 ? primary 'Johnson, C.M.' 4 ? primary 'Pan, Y.P.' 5 ? primary 'Volkmer-Engert, R.' 6 ? primary 'Schneider-Mergener, J.' 7 ? primary 'Daggett, V.' 8 ? primary 'Oschkinat, H.' 9 ? primary 'Fersht, A.' 10 ? # _cell.entry_id 1K5R _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.pdbx_unique_axis ? _cell.Z_PDB 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn '65 KDA YES-ASSOCIATED PROTEIN' 4710.266 1 ? 'S24/Amino-ethyl-sulfanyl-acetic acid' 'WW domain, residues 5-44' '40-peptide construct with synthetic Amino-ethyl-sulfanyl-acetic acid link at position 24' 2 polymer syn 'Fragment of WBP-1' 985.090 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'YAP65; yes-associated protein 65 kDa' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes 'FEIPDDVPLPAGWEMAKTS(ESD)GQRYFLNHIDQTTTWQDPRK(NH2)' FEIPDDVPLPAGWEMAKTSXGQRYFLNHIDQTTTWQDPRKX A ? 2 'polypeptide(L)' no no GTPPPPYTVG GTPPPPYTVG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 GLU n 1 3 ILE n 1 4 PRO n 1 5 ASP n 1 6 ASP n 1 7 VAL n 1 8 PRO n 1 9 LEU n 1 10 PRO n 1 11 ALA n 1 12 GLY n 1 13 TRP n 1 14 GLU n 1 15 MET n 1 16 ALA n 1 17 LYS n 1 18 THR n 1 19 SER n 1 20 ESD n 1 21 GLY n 1 22 GLN n 1 23 ARG n 1 24 TYR n 1 25 PHE n 1 26 LEU n 1 27 ASN n 1 28 HIS n 1 29 ILE n 1 30 ASP n 1 31 GLN n 1 32 THR n 1 33 THR n 1 34 THR n 1 35 TRP n 1 36 GLN n 1 37 ASP n 1 38 PRO n 1 39 ARG n 1 40 LYS n 1 41 NH2 n 2 1 GLY n 2 2 THR n 2 3 PRO n 2 4 PRO n 2 5 PRO n 2 6 PRO n 2 7 TYR n 2 8 THR n 2 9 VAL n 2 10 GLY n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample ? ? ? ? ? 'The sequence occurs naturally in humans' 2 1 sample ? ? ? ? ? 'The sequence occurs naturally in humans' # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 1 UNP YAP1_HUMAN P46937 165 FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK ? 2 2 PDB 1K5R 1K5R ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1K5R A 1 ? 40 ? P46937 165 ? 204 ? 5 44 2 2 1K5R B 1 ? 10 ? 1K5R 45 ? 54 ? 45 54 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1K5R _struct_ref_seq_dif.mon_id ESD _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 20 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P46937 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 184 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 24 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ESD non-polymer . '(2-AMINO-ETHYLSULFANYL)-ACETIC ACID' ? 'C4 H9 N O2 S' 135.185 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 1 '2D NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 288 1 6 '100 mM NaCl' atm K 2 288 1 6 '100 mM NaCl' atm K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;phosphate buffer 10 mM, Nacl 100mM, DTT 0.1mM, EDTA 0.1 mM, pH 6, WW domain 1.2 mM Ligand 2.4 mM ; 'H20 (10% D20)' 2 ;phosphate buffer 10 mM, Nacl 100mM, DTT 0.1mM, EDTA 0.1 mM, pH 6 WW domain, 1.2 mM Ligand 2.4 mM ; D2O # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1K5R _pdbx_nmr_refine.method 'simulated anneling' _pdbx_nmr_refine.details '2000K, 200 RUNS, FORCE CONSTANTS FOR NOE 50 KCALMOL-1RAD-2, 590 RESTRAINTS' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1K5R _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1K5R _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 processing BRUKER 1 X-PLOR 3.1 refinement 'Brunger, A.T.' 2 ANSIG 3.3 'data analysis' 'Kraulis, P.J.' 3 # _exptl.entry_id 1K5R _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1K5R _struct.title 'YAP65 WW domain S24-Amino-Ethylsulfanyl-Acetic Acid mutant' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K5R _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'WW domain, YAP65, beta-sheet proteins, stability of beta sheets, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 19 C ? ? ? 1_555 A ESD 20 N ? ? A SER 23 A ESD 24 1_555 ? ? ? ? ? ? ? 1.305 ? ? covale2 covale both ? A ESD 20 C ? ? ? 1_555 A GLY 21 N ? ? A ESD 24 A GLY 25 1_555 ? ? ? ? ? ? ? 1.305 ? ? covale3 covale both ? A LYS 40 C ? ? ? 1_555 A NH2 41 N ? ? A LYS 44 A NH2 45 1_555 ? ? ? ? ? ? ? 1.304 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 19 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 23 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ESD _struct_mon_prot_cis.pdbx_label_seq_id_2 20 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ESD _struct_mon_prot_cis.pdbx_auth_seq_id_2 24 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 6 _struct_mon_prot_cis.pdbx_omega_angle 3.35 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 13 ? THR A 18 ? TRP A 17 THR A 22 A 2 GLN A 22 ? ASN A 27 ? GLN A 26 ASN A 31 A 3 THR A 32 ? THR A 34 ? THR A 36 THR A 38 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 16 ? O ALA A 20 N TYR A 24 ? N TYR A 28 A 2 3 O LEU A 26 ? O LEU A 30 N THR A 33 ? N THR A 37 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 45 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 45' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id LYS _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 40 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id LYS _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 44 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _database_PDB_matrix.entry_id 1K5R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1K5R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 5 5 PHE PHE A . n A 1 2 GLU 2 6 6 GLU GLU A . n A 1 3 ILE 3 7 7 ILE ILE A . n A 1 4 PRO 4 8 8 PRO PRO A . n A 1 5 ASP 5 9 9 ASP ASP A . n A 1 6 ASP 6 10 10 ASP ASP A . n A 1 7 VAL 7 11 11 VAL VAL A . n A 1 8 PRO 8 12 12 PRO PRO A . n A 1 9 LEU 9 13 13 LEU LEU A . n A 1 10 PRO 10 14 14 PRO PRO A . n A 1 11 ALA 11 15 15 ALA ALA A . n A 1 12 GLY 12 16 16 GLY GLY A . n A 1 13 TRP 13 17 17 TRP TRP A . n A 1 14 GLU 14 18 18 GLU GLU A . n A 1 15 MET 15 19 19 MET MET A . n A 1 16 ALA 16 20 20 ALA ALA A . n A 1 17 LYS 17 21 21 LYS LYS A . n A 1 18 THR 18 22 22 THR THR A . n A 1 19 SER 19 23 23 SER SER A . n A 1 20 ESD 20 24 24 ESD ESD A . n A 1 21 GLY 21 25 25 GLY GLY A . n A 1 22 GLN 22 26 26 GLN GLN A . n A 1 23 ARG 23 27 27 ARG ARG A . n A 1 24 TYR 24 28 28 TYR TYR A . n A 1 25 PHE 25 29 29 PHE PHE A . n A 1 26 LEU 26 30 30 LEU LEU A . n A 1 27 ASN 27 31 31 ASN ASN A . n A 1 28 HIS 28 32 32 HIS HIS A . n A 1 29 ILE 29 33 33 ILE ILE A . n A 1 30 ASP 30 34 34 ASP ASP A . n A 1 31 GLN 31 35 35 GLN GLN A . n A 1 32 THR 32 36 36 THR THR A . n A 1 33 THR 33 37 37 THR THR A . n A 1 34 THR 34 38 38 THR THR A . n A 1 35 TRP 35 39 39 TRP TRP A . n A 1 36 GLN 36 40 40 GLN GLN A . n A 1 37 ASP 37 41 41 ASP ASP A . n A 1 38 PRO 38 42 42 PRO PRO A . n A 1 39 ARG 39 43 43 ARG ARG A . n A 1 40 LYS 40 44 44 LYS LYS A . n A 1 41 NH2 41 45 45 NH2 NH2 A . n B 2 1 GLY 1 45 45 GLY GLY B . n B 2 2 THR 2 46 46 THR THR B . n B 2 3 PRO 3 47 47 PRO PRO B . n B 2 4 PRO 4 48 48 PRO PRO B . n B 2 5 PRO 5 49 49 PRO PRO B . n B 2 6 PRO 6 50 50 PRO PRO B . n B 2 7 TYR 7 51 51 TYR TYR B . n B 2 8 THR 8 52 52 THR THR B . n B 2 9 VAL 9 53 53 VAL VAL B . n B 2 10 GLY 10 54 54 GLY GLY B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-11-02 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 2 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Atomic model' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' atom_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond 11 5 'Structure model' pdbx_validate_peptide_omega 12 5 'Structure model' pdbx_validate_rmsd_angle 13 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 9 5 'Structure model' '_atom_site.auth_atom_id' 10 5 'Structure model' '_atom_site.label_atom_id' 11 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 OG1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 22 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 27 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 6 ? ? 59.07 111.29 2 1 ILE A 7 ? ? 37.37 52.03 3 1 PRO A 8 ? ? -70.11 -91.00 4 1 ASP A 9 ? ? 48.69 25.40 5 1 PRO A 12 ? ? -77.45 -162.94 6 1 GLU A 18 ? ? -157.15 76.60 7 1 MET A 19 ? ? -46.25 160.05 8 1 ALA A 20 ? ? -160.47 -145.97 9 1 THR A 22 ? ? -64.70 -162.71 10 1 GLN A 26 ? ? 67.25 -61.26 11 1 ARG A 27 ? ? 55.80 173.01 12 1 LEU A 30 ? ? 47.99 93.49 13 1 ASP A 34 ? ? -96.53 -91.08 14 1 GLN A 35 ? ? 179.57 37.21 15 1 THR A 36 ? ? -157.16 -159.49 16 1 GLN A 40 ? ? -175.93 -37.47 17 1 ASP A 41 ? ? -177.84 130.73 18 1 ARG A 43 ? ? -160.88 86.81 19 1 PRO B 50 ? ? -71.08 -162.92 20 1 TYR B 51 ? ? 53.94 72.42 21 2 PRO A 8 ? ? -73.07 -90.15 22 2 ASP A 9 ? ? 65.30 -68.17 23 2 ASP A 10 ? ? -161.78 -41.01 24 2 GLU A 18 ? ? -105.94 48.71 25 2 ALA A 20 ? ? -144.08 -145.90 26 2 THR A 22 ? ? -58.35 173.64 27 2 ASN A 31 ? ? -83.18 49.93 28 2 ASP A 34 ? ? -153.82 35.41 29 2 GLN A 35 ? ? -179.03 -154.05 30 2 THR A 36 ? ? -124.94 -167.83 31 2 GLN A 40 ? ? -168.38 -36.19 32 2 PRO A 42 ? ? -75.36 -162.79 33 2 ARG A 43 ? ? -162.01 87.56 34 2 VAL B 53 ? ? 55.68 170.45 35 3 ASP A 10 ? ? -173.42 -83.88 36 3 PRO A 12 ? ? -73.10 -163.38 37 3 GLU A 18 ? ? -173.85 76.24 38 3 MET A 19 ? ? -42.98 154.54 39 3 ALA A 20 ? ? -148.75 15.08 40 3 LYS A 21 ? ? 54.98 173.74 41 3 THR A 22 ? ? -113.18 62.98 42 3 GLN A 26 ? ? -140.04 -62.40 43 3 ARG A 27 ? ? 59.80 155.41 44 3 ILE A 33 ? ? -109.52 -66.50 45 3 TRP A 39 ? ? 65.47 -69.23 46 3 ASP A 41 ? ? -178.05 -59.50 47 3 ARG A 43 ? ? -177.60 44.54 48 3 TYR B 51 ? ? 53.11 -169.60 49 3 VAL B 53 ? ? -92.29 54.31 50 4 GLU A 6 ? ? 53.64 97.77 51 4 ASP A 9 ? ? -170.96 -38.45 52 4 ASP A 10 ? ? -100.51 -79.73 53 4 VAL A 11 ? ? 57.40 168.08 54 4 PRO A 12 ? ? -72.51 -163.23 55 4 GLU A 18 ? ? -112.42 73.34 56 4 LYS A 21 ? ? 61.06 150.41 57 4 SER A 23 ? ? -52.89 -77.52 58 4 GLN A 26 ? ? -141.51 -69.25 59 4 ARG A 27 ? ? 61.54 127.74 60 4 LEU A 30 ? ? -42.40 97.92 61 4 ASP A 34 ? ? -157.26 28.57 62 4 GLN A 35 ? ? -175.70 -150.37 63 4 THR A 36 ? ? -127.40 -161.13 64 4 TRP A 39 ? ? 63.58 -74.69 65 4 GLN A 40 ? ? -61.16 -80.01 66 4 PRO A 42 ? ? -73.45 -162.99 67 4 TYR B 51 ? ? -175.64 -71.89 68 5 GLU A 6 ? ? 53.41 177.61 69 5 PRO A 8 ? ? -71.15 -137.64 70 5 ASP A 10 ? ? -159.83 86.38 71 5 LEU A 13 ? ? 60.74 149.45 72 5 ALA A 20 ? ? -115.74 -141.96 73 5 THR A 22 ? ? -56.71 -169.05 74 5 ARG A 27 ? ? 55.24 172.43 75 5 LEU A 30 ? ? 50.60 99.72 76 5 ASP A 34 ? ? -159.29 45.01 77 5 GLN A 35 ? ? -175.74 -150.62 78 5 TRP A 39 ? ? -66.59 -84.31 79 5 GLN A 40 ? ? -111.60 74.63 80 5 PRO A 42 ? ? -73.10 -163.04 81 5 ARG A 43 ? ? -112.23 62.76 82 5 THR B 52 ? ? 53.29 84.50 83 5 VAL B 53 ? ? -68.34 71.18 84 6 GLU A 6 ? ? 39.03 -160.31 85 6 PRO A 8 ? ? -72.48 -88.95 86 6 ASP A 9 ? ? -175.56 32.20 87 6 ASP A 10 ? ? -81.09 -96.21 88 6 VAL A 11 ? ? -161.28 50.96 89 6 THR A 22 ? ? -90.61 44.26 90 6 SER A 23 ? ? -177.09 -70.78 91 6 GLN A 26 ? ? -175.85 49.69 92 6 LEU A 30 ? ? -39.08 93.43 93 6 GLN A 35 ? ? 53.49 74.69 94 6 THR A 38 ? ? -86.68 -148.82 95 6 TRP A 39 ? ? -155.90 -80.96 96 6 ARG A 43 ? ? -68.27 -80.76 97 6 THR B 46 ? ? -170.14 146.70 98 6 THR B 52 ? ? 53.31 177.92 99 7 GLU A 6 ? ? 52.96 178.76 100 7 PRO A 8 ? ? -83.84 -93.26 101 7 ASP A 9 ? ? 45.44 25.98 102 7 ASP A 10 ? ? 70.39 -56.10 103 7 PRO A 12 ? ? -68.25 -158.35 104 7 LYS A 21 ? ? 59.82 158.86 105 7 GLN A 40 ? ? 48.71 27.62 106 7 ARG A 43 ? ? 44.58 93.51 107 7 THR B 46 ? ? -51.98 108.02 108 7 TYR B 51 ? ? -146.72 -43.17 109 8 PRO A 8 ? ? -75.71 -92.61 110 8 ASP A 10 ? ? 57.75 87.94 111 8 LEU A 13 ? ? 59.66 156.51 112 8 ALA A 20 ? ? -145.91 16.67 113 8 LYS A 21 ? ? 51.04 -174.88 114 8 LEU A 30 ? ? 54.25 102.43 115 8 ASN A 31 ? ? -88.35 42.25 116 8 ASP A 34 ? ? -139.32 -36.36 117 8 GLN A 35 ? ? -115.05 -145.48 118 8 TRP A 39 ? ? -51.58 -76.34 119 8 ASP A 41 ? ? -179.37 -59.24 120 8 ARG A 43 ? ? -175.29 -52.36 121 8 THR B 46 ? ? -174.82 93.98 122 8 TYR B 51 ? ? -65.87 -164.06 123 8 THR B 52 ? ? 54.10 99.13 124 9 ASP A 9 ? ? 176.25 -94.50 125 9 ASP A 10 ? ? 46.32 25.73 126 9 GLU A 18 ? ? -160.32 75.58 127 9 LYS A 21 ? ? 56.00 170.74 128 9 LEU A 30 ? ? 47.77 95.64 129 9 ASP A 34 ? ? -97.00 -94.09 130 9 GLN A 35 ? ? -178.77 39.64 131 9 THR A 36 ? ? -179.03 -160.15 132 9 TRP A 39 ? ? 57.58 -153.04 133 9 GLN A 40 ? ? -53.65 106.78 134 9 ASP A 41 ? ? -179.28 -52.36 135 9 ARG A 43 ? ? -50.27 -82.32 136 9 TYR B 51 ? ? -175.23 -178.46 137 9 THR B 52 ? ? -53.67 172.04 138 10 ILE A 7 ? ? -162.71 48.17 139 10 PRO A 8 ? ? -61.87 -88.10 140 10 ASP A 9 ? ? -137.19 -40.99 141 10 ASP A 10 ? ? -91.43 53.68 142 10 ALA A 15 ? ? 32.54 -151.69 143 10 GLN A 26 ? ? 53.23 71.69 144 10 PHE A 29 ? ? -103.07 74.11 145 10 LEU A 30 ? ? -41.95 88.03 146 10 ASP A 34 ? ? -92.05 -65.74 147 10 GLN A 35 ? ? -135.22 -111.69 148 10 THR A 37 ? ? 37.24 -158.59 149 10 THR A 38 ? ? -146.88 -54.57 150 10 GLN A 40 ? ? -150.13 18.96 151 10 ASP A 41 ? ? 51.78 85.40 152 10 ARG A 43 ? ? -159.13 -47.23 153 10 PRO B 50 ? ? -72.26 -167.77 154 10 TYR B 51 ? ? -63.53 -164.07 155 10 VAL B 53 ? ? -151.75 27.99 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 ESD N N N N 74 ESD CG C N N 75 ESD SB S N N 76 ESD CD C N N 77 ESD C1 C N N 78 ESD C C N N 79 ESD O O N N 80 ESD OXT O N N 81 ESD H H N N 82 ESD H2 H N N 83 ESD HG1 H N N 84 ESD HG2 H N N 85 ESD HD2 H N N 86 ESD HD1 H N N 87 ESD HA2 H N N 88 ESD HA1 H N N 89 ESD HXT H N N 90 GLN N N N N 91 GLN CA C N S 92 GLN C C N N 93 GLN O O N N 94 GLN CB C N N 95 GLN CG C N N 96 GLN CD C N N 97 GLN OE1 O N N 98 GLN NE2 N N N 99 GLN OXT O N N 100 GLN H H N N 101 GLN H2 H N N 102 GLN HA H N N 103 GLN HB2 H N N 104 GLN HB3 H N N 105 GLN HG2 H N N 106 GLN HG3 H N N 107 GLN HE21 H N N 108 GLN HE22 H N N 109 GLN HXT H N N 110 GLU N N N N 111 GLU CA C N S 112 GLU C C N N 113 GLU O O N N 114 GLU CB C N N 115 GLU CG C N N 116 GLU CD C N N 117 GLU OE1 O N N 118 GLU OE2 O N N 119 GLU OXT O N N 120 GLU H H N N 121 GLU H2 H N N 122 GLU HA H N N 123 GLU HB2 H N N 124 GLU HB3 H N N 125 GLU HG2 H N N 126 GLU HG3 H N N 127 GLU HE2 H N N 128 GLU HXT H N N 129 GLY N N N N 130 GLY CA C N N 131 GLY C C N N 132 GLY O O N N 133 GLY OXT O N N 134 GLY H H N N 135 GLY H2 H N N 136 GLY HA2 H N N 137 GLY HA3 H N N 138 GLY HXT H N N 139 HIS N N N N 140 HIS CA C N S 141 HIS C C N N 142 HIS O O N N 143 HIS CB C N N 144 HIS CG C Y N 145 HIS ND1 N Y N 146 HIS CD2 C Y N 147 HIS CE1 C Y N 148 HIS NE2 N Y N 149 HIS OXT O N N 150 HIS H H N N 151 HIS H2 H N N 152 HIS HA H N N 153 HIS HB2 H N N 154 HIS HB3 H N N 155 HIS HD1 H N N 156 HIS HD2 H N N 157 HIS HE1 H N N 158 HIS HE2 H N N 159 HIS HXT H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NH2 N N N N 250 NH2 HN1 H N N 251 NH2 HN2 H N N 252 PHE N N N N 253 PHE CA C N S 254 PHE C C N N 255 PHE O O N N 256 PHE CB C N N 257 PHE CG C Y N 258 PHE CD1 C Y N 259 PHE CD2 C Y N 260 PHE CE1 C Y N 261 PHE CE2 C Y N 262 PHE CZ C Y N 263 PHE OXT O N N 264 PHE H H N N 265 PHE H2 H N N 266 PHE HA H N N 267 PHE HB2 H N N 268 PHE HB3 H N N 269 PHE HD1 H N N 270 PHE HD2 H N N 271 PHE HE1 H N N 272 PHE HE2 H N N 273 PHE HZ H N N 274 PHE HXT H N N 275 PRO N N N N 276 PRO CA C N S 277 PRO C C N N 278 PRO O O N N 279 PRO CB C N N 280 PRO CG C N N 281 PRO CD C N N 282 PRO OXT O N N 283 PRO H H N N 284 PRO HA H N N 285 PRO HB2 H N N 286 PRO HB3 H N N 287 PRO HG2 H N N 288 PRO HG3 H N N 289 PRO HD2 H N N 290 PRO HD3 H N N 291 PRO HXT H N N 292 SER N N N N 293 SER CA C N S 294 SER C C N N 295 SER O O N N 296 SER CB C N N 297 SER OG O N N 298 SER OXT O N N 299 SER H H N N 300 SER H2 H N N 301 SER HA H N N 302 SER HB2 H N N 303 SER HB3 H N N 304 SER HG H N N 305 SER HXT H N N 306 THR N N N N 307 THR CA C N S 308 THR C C N N 309 THR O O N N 310 THR CB C N R 311 THR OG1 O N N 312 THR CG2 C N N 313 THR OXT O N N 314 THR H H N N 315 THR H2 H N N 316 THR HA H N N 317 THR HB H N N 318 THR HG1 H N N 319 THR HG21 H N N 320 THR HG22 H N N 321 THR HG23 H N N 322 THR HXT H N N 323 TRP N N N N 324 TRP CA C N S 325 TRP C C N N 326 TRP O O N N 327 TRP CB C N N 328 TRP CG C Y N 329 TRP CD1 C Y N 330 TRP CD2 C Y N 331 TRP NE1 N Y N 332 TRP CE2 C Y N 333 TRP CE3 C Y N 334 TRP CZ2 C Y N 335 TRP CZ3 C Y N 336 TRP CH2 C Y N 337 TRP OXT O N N 338 TRP H H N N 339 TRP H2 H N N 340 TRP HA H N N 341 TRP HB2 H N N 342 TRP HB3 H N N 343 TRP HD1 H N N 344 TRP HE1 H N N 345 TRP HE3 H N N 346 TRP HZ2 H N N 347 TRP HZ3 H N N 348 TRP HH2 H N N 349 TRP HXT H N N 350 TYR N N N N 351 TYR CA C N S 352 TYR C C N N 353 TYR O O N N 354 TYR CB C N N 355 TYR CG C Y N 356 TYR CD1 C Y N 357 TYR CD2 C Y N 358 TYR CE1 C Y N 359 TYR CE2 C Y N 360 TYR CZ C Y N 361 TYR OH O N N 362 TYR OXT O N N 363 TYR H H N N 364 TYR H2 H N N 365 TYR HA H N N 366 TYR HB2 H N N 367 TYR HB3 H N N 368 TYR HD1 H N N 369 TYR HD2 H N N 370 TYR HE1 H N N 371 TYR HE2 H N N 372 TYR HH H N N 373 TYR HXT H N N 374 VAL N N N N 375 VAL CA C N S 376 VAL C C N N 377 VAL O O N N 378 VAL CB C N N 379 VAL CG1 C N N 380 VAL CG2 C N N 381 VAL OXT O N N 382 VAL H H N N 383 VAL H2 H N N 384 VAL HA H N N 385 VAL HB H N N 386 VAL HG11 H N N 387 VAL HG12 H N N 388 VAL HG13 H N N 389 VAL HG21 H N N 390 VAL HG22 H N N 391 VAL HG23 H N N 392 VAL HXT H N N 393 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 ESD N CD sing N N 70 ESD N H sing N N 71 ESD N H2 sing N N 72 ESD CG SB sing N N 73 ESD CG CD sing N N 74 ESD CG HG1 sing N N 75 ESD CG HG2 sing N N 76 ESD SB C1 sing N N 77 ESD CD HD2 sing N N 78 ESD CD HD1 sing N N 79 ESD C1 C sing N N 80 ESD C1 HA2 sing N N 81 ESD C1 HA1 sing N N 82 ESD C O doub N N 83 ESD C OXT sing N N 84 ESD OXT HXT sing N N 85 GLN N CA sing N N 86 GLN N H sing N N 87 GLN N H2 sing N N 88 GLN CA C sing N N 89 GLN CA CB sing N N 90 GLN CA HA sing N N 91 GLN C O doub N N 92 GLN C OXT sing N N 93 GLN CB CG sing N N 94 GLN CB HB2 sing N N 95 GLN CB HB3 sing N N 96 GLN CG CD sing N N 97 GLN CG HG2 sing N N 98 GLN CG HG3 sing N N 99 GLN CD OE1 doub N N 100 GLN CD NE2 sing N N 101 GLN NE2 HE21 sing N N 102 GLN NE2 HE22 sing N N 103 GLN OXT HXT sing N N 104 GLU N CA sing N N 105 GLU N H sing N N 106 GLU N H2 sing N N 107 GLU CA C sing N N 108 GLU CA CB sing N N 109 GLU CA HA sing N N 110 GLU C O doub N N 111 GLU C OXT sing N N 112 GLU CB CG sing N N 113 GLU CB HB2 sing N N 114 GLU CB HB3 sing N N 115 GLU CG CD sing N N 116 GLU CG HG2 sing N N 117 GLU CG HG3 sing N N 118 GLU CD OE1 doub N N 119 GLU CD OE2 sing N N 120 GLU OE2 HE2 sing N N 121 GLU OXT HXT sing N N 122 GLY N CA sing N N 123 GLY N H sing N N 124 GLY N H2 sing N N 125 GLY CA C sing N N 126 GLY CA HA2 sing N N 127 GLY CA HA3 sing N N 128 GLY C O doub N N 129 GLY C OXT sing N N 130 GLY OXT HXT sing N N 131 HIS N CA sing N N 132 HIS N H sing N N 133 HIS N H2 sing N N 134 HIS CA C sing N N 135 HIS CA CB sing N N 136 HIS CA HA sing N N 137 HIS C O doub N N 138 HIS C OXT sing N N 139 HIS CB CG sing N N 140 HIS CB HB2 sing N N 141 HIS CB HB3 sing N N 142 HIS CG ND1 sing Y N 143 HIS CG CD2 doub Y N 144 HIS ND1 CE1 doub Y N 145 HIS ND1 HD1 sing N N 146 HIS CD2 NE2 sing Y N 147 HIS CD2 HD2 sing N N 148 HIS CE1 NE2 sing Y N 149 HIS CE1 HE1 sing N N 150 HIS NE2 HE2 sing N N 151 HIS OXT HXT sing N N 152 ILE N CA sing N N 153 ILE N H sing N N 154 ILE N H2 sing N N 155 ILE CA C sing N N 156 ILE CA CB sing N N 157 ILE CA HA sing N N 158 ILE C O doub N N 159 ILE C OXT sing N N 160 ILE CB CG1 sing N N 161 ILE CB CG2 sing N N 162 ILE CB HB sing N N 163 ILE CG1 CD1 sing N N 164 ILE CG1 HG12 sing N N 165 ILE CG1 HG13 sing N N 166 ILE CG2 HG21 sing N N 167 ILE CG2 HG22 sing N N 168 ILE CG2 HG23 sing N N 169 ILE CD1 HD11 sing N N 170 ILE CD1 HD12 sing N N 171 ILE CD1 HD13 sing N N 172 ILE OXT HXT sing N N 173 LEU N CA sing N N 174 LEU N H sing N N 175 LEU N H2 sing N N 176 LEU CA C sing N N 177 LEU CA CB sing N N 178 LEU CA HA sing N N 179 LEU C O doub N N 180 LEU C OXT sing N N 181 LEU CB CG sing N N 182 LEU CB HB2 sing N N 183 LEU CB HB3 sing N N 184 LEU CG CD1 sing N N 185 LEU CG CD2 sing N N 186 LEU CG HG sing N N 187 LEU CD1 HD11 sing N N 188 LEU CD1 HD12 sing N N 189 LEU CD1 HD13 sing N N 190 LEU CD2 HD21 sing N N 191 LEU CD2 HD22 sing N N 192 LEU CD2 HD23 sing N N 193 LEU OXT HXT sing N N 194 LYS N CA sing N N 195 LYS N H sing N N 196 LYS N H2 sing N N 197 LYS CA C sing N N 198 LYS CA CB sing N N 199 LYS CA HA sing N N 200 LYS C O doub N N 201 LYS C OXT sing N N 202 LYS CB CG sing N N 203 LYS CB HB2 sing N N 204 LYS CB HB3 sing N N 205 LYS CG CD sing N N 206 LYS CG HG2 sing N N 207 LYS CG HG3 sing N N 208 LYS CD CE sing N N 209 LYS CD HD2 sing N N 210 LYS CD HD3 sing N N 211 LYS CE NZ sing N N 212 LYS CE HE2 sing N N 213 LYS CE HE3 sing N N 214 LYS NZ HZ1 sing N N 215 LYS NZ HZ2 sing N N 216 LYS NZ HZ3 sing N N 217 LYS OXT HXT sing N N 218 MET N CA sing N N 219 MET N H sing N N 220 MET N H2 sing N N 221 MET CA C sing N N 222 MET CA CB sing N N 223 MET CA HA sing N N 224 MET C O doub N N 225 MET C OXT sing N N 226 MET CB CG sing N N 227 MET CB HB2 sing N N 228 MET CB HB3 sing N N 229 MET CG SD sing N N 230 MET CG HG2 sing N N 231 MET CG HG3 sing N N 232 MET SD CE sing N N 233 MET CE HE1 sing N N 234 MET CE HE2 sing N N 235 MET CE HE3 sing N N 236 MET OXT HXT sing N N 237 NH2 N HN1 sing N N 238 NH2 N HN2 sing N N 239 PHE N CA sing N N 240 PHE N H sing N N 241 PHE N H2 sing N N 242 PHE CA C sing N N 243 PHE CA CB sing N N 244 PHE CA HA sing N N 245 PHE C O doub N N 246 PHE C OXT sing N N 247 PHE CB CG sing N N 248 PHE CB HB2 sing N N 249 PHE CB HB3 sing N N 250 PHE CG CD1 doub Y N 251 PHE CG CD2 sing Y N 252 PHE CD1 CE1 sing Y N 253 PHE CD1 HD1 sing N N 254 PHE CD2 CE2 doub Y N 255 PHE CD2 HD2 sing N N 256 PHE CE1 CZ doub Y N 257 PHE CE1 HE1 sing N N 258 PHE CE2 CZ sing Y N 259 PHE CE2 HE2 sing N N 260 PHE CZ HZ sing N N 261 PHE OXT HXT sing N N 262 PRO N CA sing N N 263 PRO N CD sing N N 264 PRO N H sing N N 265 PRO CA C sing N N 266 PRO CA CB sing N N 267 PRO CA HA sing N N 268 PRO C O doub N N 269 PRO C OXT sing N N 270 PRO CB CG sing N N 271 PRO CB HB2 sing N N 272 PRO CB HB3 sing N N 273 PRO CG CD sing N N 274 PRO CG HG2 sing N N 275 PRO CG HG3 sing N N 276 PRO CD HD2 sing N N 277 PRO CD HD3 sing N N 278 PRO OXT HXT sing N N 279 SER N CA sing N N 280 SER N H sing N N 281 SER N H2 sing N N 282 SER CA C sing N N 283 SER CA CB sing N N 284 SER CA HA sing N N 285 SER C O doub N N 286 SER C OXT sing N N 287 SER CB OG sing N N 288 SER CB HB2 sing N N 289 SER CB HB3 sing N N 290 SER OG HG sing N N 291 SER OXT HXT sing N N 292 THR N CA sing N N 293 THR N H sing N N 294 THR N H2 sing N N 295 THR CA C sing N N 296 THR CA CB sing N N 297 THR CA HA sing N N 298 THR C O doub N N 299 THR C OXT sing N N 300 THR CB OG1 sing N N 301 THR CB CG2 sing N N 302 THR CB HB sing N N 303 THR OG1 HG1 sing N N 304 THR CG2 HG21 sing N N 305 THR CG2 HG22 sing N N 306 THR CG2 HG23 sing N N 307 THR OXT HXT sing N N 308 TRP N CA sing N N 309 TRP N H sing N N 310 TRP N H2 sing N N 311 TRP CA C sing N N 312 TRP CA CB sing N N 313 TRP CA HA sing N N 314 TRP C O doub N N 315 TRP C OXT sing N N 316 TRP CB CG sing N N 317 TRP CB HB2 sing N N 318 TRP CB HB3 sing N N 319 TRP CG CD1 doub Y N 320 TRP CG CD2 sing Y N 321 TRP CD1 NE1 sing Y N 322 TRP CD1 HD1 sing N N 323 TRP CD2 CE2 doub Y N 324 TRP CD2 CE3 sing Y N 325 TRP NE1 CE2 sing Y N 326 TRP NE1 HE1 sing N N 327 TRP CE2 CZ2 sing Y N 328 TRP CE3 CZ3 doub Y N 329 TRP CE3 HE3 sing N N 330 TRP CZ2 CH2 doub Y N 331 TRP CZ2 HZ2 sing N N 332 TRP CZ3 CH2 sing Y N 333 TRP CZ3 HZ3 sing N N 334 TRP CH2 HH2 sing N N 335 TRP OXT HXT sing N N 336 TYR N CA sing N N 337 TYR N H sing N N 338 TYR N H2 sing N N 339 TYR CA C sing N N 340 TYR CA CB sing N N 341 TYR CA HA sing N N 342 TYR C O doub N N 343 TYR C OXT sing N N 344 TYR CB CG sing N N 345 TYR CB HB2 sing N N 346 TYR CB HB3 sing N N 347 TYR CG CD1 doub Y N 348 TYR CG CD2 sing Y N 349 TYR CD1 CE1 sing Y N 350 TYR CD1 HD1 sing N N 351 TYR CD2 CE2 doub Y N 352 TYR CD2 HD2 sing N N 353 TYR CE1 CZ doub Y N 354 TYR CE1 HE1 sing N N 355 TYR CE2 CZ sing Y N 356 TYR CE2 HE2 sing N N 357 TYR CZ OH sing N N 358 TYR OH HH sing N N 359 TYR OXT HXT sing N N 360 VAL N CA sing N N 361 VAL N H sing N N 362 VAL N H2 sing N N 363 VAL CA C sing N N 364 VAL CA CB sing N N 365 VAL CA HA sing N N 366 VAL C O doub N N 367 VAL C OXT sing N N 368 VAL CB CG1 sing N N 369 VAL CB CG2 sing N N 370 VAL CB HB sing N N 371 VAL CG1 HG11 sing N N 372 VAL CG1 HG12 sing N N 373 VAL CG1 HG13 sing N N 374 VAL CG2 HG21 sing N N 375 VAL CG2 HG22 sing N N 376 VAL CG2 HG23 sing N N 377 VAL OXT HXT sing N N 378 #