data_1K91 # _entry.id 1K91 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1K91 pdb_00001k91 10.2210/pdb1k91/pdb RCSB RCSB014711 ? ? WWPDB D_1000014711 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-10-12 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K91 _pdbx_database_status.recvd_initial_deposition_date 2001-10-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1HHN 'Calreticulin P-domain' unspecified PDB 1K9C 'Calreticulin P-domain (residues 189-261)' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ellgaard, L.' 1 'Bettendorff, P.' 2 'Braun, D.' 3 'Herrmann, T.' 4 'Fiorito, F.' 5 'Guntert, P.' 6 'Helenius, A.' 7 'Wuthrich, K.' 8 # _citation.id primary _citation.title 'NMR Structures of 36 and 73-residue Fragments of the Calreticulin P-domain' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 322 _citation.page_first 773 _citation.page_last 784 _citation.year 2002 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12270713 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(02)00812-4' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ellgaard, L.' 1 ? primary 'Bettendorff, P.' 2 ? primary 'Braun, D.' 3 ? primary 'Herrmann, T.' 4 ? primary 'Fiorito, F.' 5 ? primary 'Jelesarov, I.' 6 ? primary 'Guntert, P.' 7 ? primary 'Helenius, A.' 8 ? primary 'Wuthrich, K.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CALRETICULIN _entity.formula_weight 4308.620 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'P-DOMAIN, RESIDUES 221-256' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CRP55; CALREGULIN; HACBP; ERP60; CALBP; CALCIUM-BINDING PROTEIN 3; CABP3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKG _entity_poly.pdbx_seq_one_letter_code_can GKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LYS n 1 3 PRO n 1 4 GLU n 1 5 HIS n 1 6 ILE n 1 7 PRO n 1 8 ASP n 1 9 PRO n 1 10 ASP n 1 11 ALA n 1 12 LYS n 1 13 LYS n 1 14 PRO n 1 15 GLU n 1 16 ASP n 1 17 TRP n 1 18 ASP n 1 19 GLU n 1 20 GLU n 1 21 MET n 1 22 ASP n 1 23 GLY n 1 24 GLU n 1 25 TRP n 1 26 GLU n 1 27 PRO n 1 28 PRO n 1 29 VAL n 1 30 ILE n 1 31 GLN n 1 32 ASN n 1 33 PRO n 1 34 GLU n 1 35 TYR n 1 36 LYS n 1 37 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 220 220 GLY GLY A . n A 1 2 LYS 2 221 221 LYS LYS A . n A 1 3 PRO 3 222 222 PRO PRO A . n A 1 4 GLU 4 223 223 GLU GLU A . n A 1 5 HIS 5 224 224 HIS HIS A . n A 1 6 ILE 6 225 225 ILE ILE A . n A 1 7 PRO 7 226 226 PRO PRO A . n A 1 8 ASP 8 227 227 ASP ASP A . n A 1 9 PRO 9 228 228 PRO PRO A . n A 1 10 ASP 10 229 229 ASP ASP A . n A 1 11 ALA 11 230 230 ALA ALA A . n A 1 12 LYS 12 231 231 LYS LYS A . n A 1 13 LYS 13 232 232 LYS LYS A . n A 1 14 PRO 14 233 233 PRO PRO A . n A 1 15 GLU 15 234 234 GLU GLU A . n A 1 16 ASP 16 235 235 ASP ASP A . n A 1 17 TRP 17 236 236 TRP TRP A . n A 1 18 ASP 18 237 237 ASP ASP A . n A 1 19 GLU 19 238 238 GLU GLU A . n A 1 20 GLU 20 239 239 GLU GLU A . n A 1 21 MET 21 240 240 MET MET A . n A 1 22 ASP 22 241 241 ASP ASP A . n A 1 23 GLY 23 242 242 GLY GLY A . n A 1 24 GLU 24 243 243 GLU GLU A . n A 1 25 TRP 25 244 244 TRP TRP A . n A 1 26 GLU 26 245 245 GLU GLU A . n A 1 27 PRO 27 246 246 PRO PRO A . n A 1 28 PRO 28 247 247 PRO PRO A . n A 1 29 VAL 29 248 248 VAL VAL A . n A 1 30 ILE 30 249 249 ILE ILE A . n A 1 31 GLN 31 250 250 GLN GLN A . n A 1 32 ASN 32 251 251 ASN ASN A . n A 1 33 PRO 33 252 252 PRO PRO A . n A 1 34 GLU 34 253 253 GLU GLU A . n A 1 35 TYR 35 254 254 TYR TYR A . n A 1 36 LYS 36 255 255 LYS LYS A . n A 1 37 GLY 37 256 256 GLY GLY A . n # _exptl.entry_id 1K91 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1K91 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1K91 _struct.title 'Solution Structure of Calreticulin P-domain subdomain (residues 221-256)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K91 _struct_keywords.pdbx_keywords 'METAL TRANSPORT' _struct_keywords.text 'HAIRPIN, METAL TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code CRTC_RAT _struct_ref.pdbx_db_accession P18418 _struct_ref.pdbx_align_begin 242 _struct_ref.pdbx_seq_one_letter_code KPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKG _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1K91 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18418 _struct_ref_seq.db_align_beg 242 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 277 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 221 _struct_ref_seq.pdbx_auth_seq_align_end 256 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1K91 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P18418 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 220 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 18 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 237 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 242 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 5 ? PRO A 7 ? HIS A 224 PRO A 226 A 2 VAL A 29 ? GLN A 31 ? VAL A 248 GLN A 250 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 6 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 225 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 249 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 14 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 223 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TYR _pdbx_validate_close_contact.auth_seq_id_2 254 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 232 ? ? -34.39 121.89 2 1 PRO A 247 ? ? -68.41 -170.80 3 3 MET A 240 ? ? -90.57 -70.29 4 3 PRO A 247 ? ? -66.62 -179.12 5 3 GLU A 253 ? ? -152.30 81.59 6 3 LYS A 255 ? ? -133.86 -61.60 7 4 ASP A 241 ? ? -81.15 -80.33 8 5 ASP A 235 ? ? -92.01 53.10 9 5 MET A 240 ? ? -91.37 -65.04 10 7 ASP A 237 ? ? -119.95 74.15 11 7 MET A 240 ? ? -109.53 -65.04 12 7 PRO A 247 ? ? -60.25 -178.55 13 7 GLU A 253 ? ? -155.24 47.82 14 8 ASP A 237 ? ? -115.30 79.13 15 8 ASP A 241 ? ? -115.17 -75.84 16 8 PRO A 247 ? ? -67.15 -174.60 17 8 GLU A 253 ? ? -152.97 79.89 18 8 LYS A 255 ? ? -136.60 -83.67 19 9 LYS A 232 ? ? -37.37 126.54 20 9 ASP A 241 ? ? -106.99 -74.52 21 9 PRO A 247 ? ? -66.53 -174.96 22 10 MET A 240 ? ? -99.63 -62.79 23 10 GLU A 253 ? ? -150.15 48.83 24 10 LYS A 255 ? ? -141.12 -58.11 25 11 PRO A 247 ? ? -73.91 -167.28 26 12 MET A 240 ? ? -90.18 -67.52 27 12 PRO A 247 ? ? -69.83 -177.56 28 13 ASP A 235 ? ? -86.63 33.38 29 13 MET A 240 ? ? -91.42 -63.80 30 13 PRO A 247 ? ? -62.34 -175.97 31 13 PRO A 252 ? ? -69.90 3.88 32 13 GLU A 253 ? ? -161.23 82.80 33 14 LYS A 232 ? ? -31.39 142.70 34 14 ASP A 235 ? ? -73.72 36.45 35 14 GLU A 238 ? ? -65.14 1.25 36 14 ASP A 241 ? ? -83.21 -76.18 37 14 PRO A 247 ? ? -68.52 -175.04 38 14 LYS A 255 ? ? -126.86 -64.13 39 15 LYS A 232 ? ? -45.85 151.30 40 15 ASP A 235 ? ? -84.94 33.76 41 15 MET A 240 ? ? -93.07 -64.36 42 15 PRO A 247 ? ? -63.69 -177.46 43 15 GLU A 253 ? ? -146.23 -58.74 44 15 TYR A 254 ? ? 56.37 151.61 45 15 LYS A 255 ? ? -141.37 -36.18 46 16 ASP A 235 ? ? -82.40 33.77 47 16 MET A 240 ? ? -100.51 -65.75 48 16 PRO A 247 ? ? -69.47 -173.64 49 16 GLU A 253 ? ? -150.20 26.57 50 17 PRO A 247 ? ? -69.76 -173.35 51 17 LYS A 255 ? ? -133.18 -45.66 52 18 LYS A 221 ? ? -17.34 116.04 53 18 ALA A 230 ? ? -51.98 109.40 54 18 PRO A 252 ? ? -68.00 5.32 55 18 GLU A 253 ? ? -172.48 77.29 56 19 LYS A 232 ? ? -36.17 128.88 57 19 ASP A 241 ? ? -93.36 -63.45 58 19 GLU A 243 ? ? -58.00 108.74 59 19 PRO A 247 ? ? -69.84 -170.38 60 19 LYS A 255 ? ? -140.68 28.16 61 20 ASP A 237 ? ? -115.87 79.87 62 20 PRO A 247 ? ? -67.78 -176.81 63 20 GLU A 253 ? ? -133.67 -44.23 64 20 TYR A 254 ? ? 33.32 93.10 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 LYS A 255 ? ? GLY A 256 ? ? 135.52 2 3 GLU A 253 ? ? TYR A 254 ? ? 147.31 3 4 LYS A 255 ? ? GLY A 256 ? ? 147.31 4 19 GLY A 220 ? ? LYS A 221 ? ? 148.47 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 20 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 254 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.079 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1K91 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1K91 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '5.3 mM CALRETICULIN P-DOMAIN SUBDOMAIN; 25 mM NaCl; 50 mM Sodium Phosphate Buffer;90% H20 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H20 10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 280 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '25 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 1 1 '2D NOESY' 3 1 1 E-COSY 4 1 1 '2D TOCSY' # _pdbx_nmr_refine.entry_id 1K91 _pdbx_nmr_refine.method 'torsion angle dynamics simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 DYANA 1.82 'structure solution' Guentert 2 DYANA 1.82 refinement Guentert 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LYS N N N N 139 LYS CA C N S 140 LYS C C N N 141 LYS O O N N 142 LYS CB C N N 143 LYS CG C N N 144 LYS CD C N N 145 LYS CE C N N 146 LYS NZ N N N 147 LYS OXT O N N 148 LYS H H N N 149 LYS H2 H N N 150 LYS HA H N N 151 LYS HB2 H N N 152 LYS HB3 H N N 153 LYS HG2 H N N 154 LYS HG3 H N N 155 LYS HD2 H N N 156 LYS HD3 H N N 157 LYS HE2 H N N 158 LYS HE3 H N N 159 LYS HZ1 H N N 160 LYS HZ2 H N N 161 LYS HZ3 H N N 162 LYS HXT H N N 163 MET N N N N 164 MET CA C N S 165 MET C C N N 166 MET O O N N 167 MET CB C N N 168 MET CG C N N 169 MET SD S N N 170 MET CE C N N 171 MET OXT O N N 172 MET H H N N 173 MET H2 H N N 174 MET HA H N N 175 MET HB2 H N N 176 MET HB3 H N N 177 MET HG2 H N N 178 MET HG3 H N N 179 MET HE1 H N N 180 MET HE2 H N N 181 MET HE3 H N N 182 MET HXT H N N 183 PRO N N N N 184 PRO CA C N S 185 PRO C C N N 186 PRO O O N N 187 PRO CB C N N 188 PRO CG C N N 189 PRO CD C N N 190 PRO OXT O N N 191 PRO H H N N 192 PRO HA H N N 193 PRO HB2 H N N 194 PRO HB3 H N N 195 PRO HG2 H N N 196 PRO HG3 H N N 197 PRO HD2 H N N 198 PRO HD3 H N N 199 PRO HXT H N N 200 TRP N N N N 201 TRP CA C N S 202 TRP C C N N 203 TRP O O N N 204 TRP CB C N N 205 TRP CG C Y N 206 TRP CD1 C Y N 207 TRP CD2 C Y N 208 TRP NE1 N Y N 209 TRP CE2 C Y N 210 TRP CE3 C Y N 211 TRP CZ2 C Y N 212 TRP CZ3 C Y N 213 TRP CH2 C Y N 214 TRP OXT O N N 215 TRP H H N N 216 TRP H2 H N N 217 TRP HA H N N 218 TRP HB2 H N N 219 TRP HB3 H N N 220 TRP HD1 H N N 221 TRP HE1 H N N 222 TRP HE3 H N N 223 TRP HZ2 H N N 224 TRP HZ3 H N N 225 TRP HH2 H N N 226 TRP HXT H N N 227 TYR N N N N 228 TYR CA C N S 229 TYR C C N N 230 TYR O O N N 231 TYR CB C N N 232 TYR CG C Y N 233 TYR CD1 C Y N 234 TYR CD2 C Y N 235 TYR CE1 C Y N 236 TYR CE2 C Y N 237 TYR CZ C Y N 238 TYR OH O N N 239 TYR OXT O N N 240 TYR H H N N 241 TYR H2 H N N 242 TYR HA H N N 243 TYR HB2 H N N 244 TYR HB3 H N N 245 TYR HD1 H N N 246 TYR HD2 H N N 247 TYR HE1 H N N 248 TYR HE2 H N N 249 TYR HH H N N 250 TYR HXT H N N 251 VAL N N N N 252 VAL CA C N S 253 VAL C C N N 254 VAL O O N N 255 VAL CB C N N 256 VAL CG1 C N N 257 VAL CG2 C N N 258 VAL OXT O N N 259 VAL H H N N 260 VAL H2 H N N 261 VAL HA H N N 262 VAL HB H N N 263 VAL HG11 H N N 264 VAL HG12 H N N 265 VAL HG13 H N N 266 VAL HG21 H N N 267 VAL HG22 H N N 268 VAL HG23 H N N 269 VAL HXT H N N 270 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PRO N CA sing N N 175 PRO N CD sing N N 176 PRO N H sing N N 177 PRO CA C sing N N 178 PRO CA CB sing N N 179 PRO CA HA sing N N 180 PRO C O doub N N 181 PRO C OXT sing N N 182 PRO CB CG sing N N 183 PRO CB HB2 sing N N 184 PRO CB HB3 sing N N 185 PRO CG CD sing N N 186 PRO CG HG2 sing N N 187 PRO CG HG3 sing N N 188 PRO CD HD2 sing N N 189 PRO CD HD3 sing N N 190 PRO OXT HXT sing N N 191 TRP N CA sing N N 192 TRP N H sing N N 193 TRP N H2 sing N N 194 TRP CA C sing N N 195 TRP CA CB sing N N 196 TRP CA HA sing N N 197 TRP C O doub N N 198 TRP C OXT sing N N 199 TRP CB CG sing N N 200 TRP CB HB2 sing N N 201 TRP CB HB3 sing N N 202 TRP CG CD1 doub Y N 203 TRP CG CD2 sing Y N 204 TRP CD1 NE1 sing Y N 205 TRP CD1 HD1 sing N N 206 TRP CD2 CE2 doub Y N 207 TRP CD2 CE3 sing Y N 208 TRP NE1 CE2 sing Y N 209 TRP NE1 HE1 sing N N 210 TRP CE2 CZ2 sing Y N 211 TRP CE3 CZ3 doub Y N 212 TRP CE3 HE3 sing N N 213 TRP CZ2 CH2 doub Y N 214 TRP CZ2 HZ2 sing N N 215 TRP CZ3 CH2 sing Y N 216 TRP CZ3 HZ3 sing N N 217 TRP CH2 HH2 sing N N 218 TRP OXT HXT sing N N 219 TYR N CA sing N N 220 TYR N H sing N N 221 TYR N H2 sing N N 222 TYR CA C sing N N 223 TYR CA CB sing N N 224 TYR CA HA sing N N 225 TYR C O doub N N 226 TYR C OXT sing N N 227 TYR CB CG sing N N 228 TYR CB HB2 sing N N 229 TYR CB HB3 sing N N 230 TYR CG CD1 doub Y N 231 TYR CG CD2 sing Y N 232 TYR CD1 CE1 sing Y N 233 TYR CD1 HD1 sing N N 234 TYR CD2 CE2 doub Y N 235 TYR CD2 HD2 sing N N 236 TYR CE1 CZ doub Y N 237 TYR CE1 HE1 sing N N 238 TYR CE2 CZ sing Y N 239 TYR CE2 HE2 sing N N 240 TYR CZ OH sing N N 241 TYR OH HH sing N N 242 TYR OXT HXT sing N N 243 VAL N CA sing N N 244 VAL N H sing N N 245 VAL N H2 sing N N 246 VAL CA C sing N N 247 VAL CA CB sing N N 248 VAL CA HA sing N N 249 VAL C O doub N N 250 VAL C OXT sing N N 251 VAL CB CG1 sing N N 252 VAL CB CG2 sing N N 253 VAL CB HB sing N N 254 VAL CG1 HG11 sing N N 255 VAL CG1 HG12 sing N N 256 VAL CG1 HG13 sing N N 257 VAL CG2 HG21 sing N N 258 VAL CG2 HG22 sing N N 259 VAL CG2 HG23 sing N N 260 VAL OXT HXT sing N N 261 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 800 2 ? Bruker DRX 750 3 ? Bruker DRX 600 # _atom_sites.entry_id 1K91 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_