data_1K9Q # _entry.id 1K9Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1K9Q pdb_00001k9q 10.2210/pdb1k9q/pdb RCSB RCSB014736 ? ? WWPDB D_1000014736 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-12-28 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-12-12 5 'Structure model' 1 4 2013-03-13 6 'Structure model' 1 5 2021-11-10 7 'Structure model' 1 6 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Other 4 5 'Structure model' Other 5 6 'Structure model' 'Data collection' 6 6 'Structure model' 'Database references' 7 6 'Structure model' 'Derived calculations' 8 7 'Structure model' 'Data collection' 9 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 6 'Structure model' database_2 2 6 'Structure model' pdbx_nmr_software 3 6 'Structure model' pdbx_struct_assembly 4 6 'Structure model' pdbx_struct_oper_list 5 6 'Structure model' struct_conn 6 6 'Structure model' struct_ref_seq_dif 7 6 'Structure model' struct_site 8 7 'Structure model' chem_comp_atom 9 7 'Structure model' chem_comp_bond 10 7 'Structure model' pdbx_entry_details 11 7 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 6 'Structure model' '_database_2.pdbx_DOI' 2 6 'Structure model' '_database_2.pdbx_database_accession' 3 6 'Structure model' '_pdbx_nmr_software.name' 4 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 6 'Structure model' '_struct_ref_seq_dif.details' 6 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K9Q _pdbx_database_status.recvd_initial_deposition_date 2001-10-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1JMQ '1JMQ contains YAP65 (L30K mutant) WW domain in Complexed with GTPPPPYTVG peptide' unspecified PDB 1E0M '1E0M contains Prototype Ww Domain' unspecified PDB 1EG3 '1EG3 contains Dystrophin Ww Domain Fragment' unspecified PDB 1EG4 '1EG4 contains Dystrophin Ww Domain Fragment In Complexed With beta-Dystroglycan Peptide' unspecified PDB 1I5H '1I5H contains Rnedd4 Wwiii Domain-Renac Bp2 Peptide Complex' unspecified PDB 1K9R '1K9R contains YAP65 WW domain complexed with Acetyl-PLPPY' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pires, J.R.' 1 'Taha-Nejad, F.' 2 'Toepert, F.' 3 'Ast, T.' 4 'Hoffmuller, U.' 5 'Schneider-Mergener, J.' 6 'Kuhne, R.' 7 'Macias, M.J.' 8 'Oschkinat, H.' 9 # _citation.id primary _citation.title ;Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 314 _citation.page_first 1147 _citation.page_last 1156 _citation.year 2001 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11743730 _citation.pdbx_database_id_DOI 10.1006/jmbi.2000.5199 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pires, J.R.' 1 ? primary 'Taha-Nejad, F.' 2 ? primary 'Toepert, F.' 3 ? primary 'Ast, T.' 4 ? primary 'Hoffmuller, U.' 5 ? primary 'Schneider-Mergener, J.' 6 ? primary 'Kuhne, R.' 7 ? primary 'Macias, M.J.' 8 ? primary 'Oschkinat, H.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn '65 kDa Yes-associated protein' 4682.166 1 ? ? 'Wild type WW domain' ? 2 polymer syn 'WW domain binding protein-1' 527.593 1 ? P3G 'residues 149-153' ? 3 non-polymer syn N-OCTANE 114.229 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 YAP65 2 WBP-1 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK A ? 2 'polypeptide(L)' no yes 'GPPPY(NH2)' GPPPYX B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name N-OCTANE _pdbx_entity_nonpoly.comp_id OCT # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 GLU n 1 3 ILE n 1 4 PRO n 1 5 ASP n 1 6 ASP n 1 7 VAL n 1 8 PRO n 1 9 LEU n 1 10 PRO n 1 11 ALA n 1 12 GLY n 1 13 TRP n 1 14 GLU n 1 15 MET n 1 16 ALA n 1 17 LYS n 1 18 THR n 1 19 SER n 1 20 SER n 1 21 GLY n 1 22 GLN n 1 23 ARG n 1 24 TYR n 1 25 PHE n 1 26 LEU n 1 27 ASN n 1 28 HIS n 1 29 ILE n 1 30 ASP n 1 31 GLN n 1 32 THR n 1 33 THR n 1 34 THR n 1 35 TRP n 1 36 GLN n 1 37 ASP n 1 38 PRO n 1 39 ARG n 1 40 LYS n 2 1 GLY n 2 2 PRO n 2 3 PRO n 2 4 PRO n 2 5 TYR n 2 6 NH2 n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample ? ? ? ? ? 'This sequence was synthetically obtained, by semiautomated spot synthesis in a cellulose support.' 2 1 sample ? ? 'Homo sapiens' ? 9606 'This sequence was synthetically obtained by spot synthesis in a cellulose support.' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 OCT non-polymer . N-OCTANE ? 'C8 H18' 114.229 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 5 5 PHE PHE A . n A 1 2 GLU 2 6 6 GLU GLU A . n A 1 3 ILE 3 7 7 ILE ILE A . n A 1 4 PRO 4 8 8 PRO PRO A . n A 1 5 ASP 5 9 9 ASP ASP A . n A 1 6 ASP 6 10 10 ASP ASP A . n A 1 7 VAL 7 11 11 VAL VAL A . n A 1 8 PRO 8 12 12 PRO PRO A . n A 1 9 LEU 9 13 13 LEU LEU A . n A 1 10 PRO 10 14 14 PRO PRO A . n A 1 11 ALA 11 15 15 ALA ALA A . n A 1 12 GLY 12 16 16 GLY GLY A . n A 1 13 TRP 13 17 17 TRP TRP A . n A 1 14 GLU 14 18 18 GLU GLU A . n A 1 15 MET 15 19 19 MET MET A . n A 1 16 ALA 16 20 20 ALA ALA A . n A 1 17 LYS 17 21 21 LYS LYS A . n A 1 18 THR 18 22 22 THR THR A . n A 1 19 SER 19 23 23 SER SER A . n A 1 20 SER 20 24 24 SER SER A . n A 1 21 GLY 21 25 25 GLY GLY A . n A 1 22 GLN 22 26 26 GLN GLN A . n A 1 23 ARG 23 27 27 ARG ARG A . n A 1 24 TYR 24 28 28 TYR TYR A . n A 1 25 PHE 25 29 29 PHE PHE A . n A 1 26 LEU 26 30 30 LEU LEU A . n A 1 27 ASN 27 31 31 ASN ASN A . n A 1 28 HIS 28 32 32 HIS HIS A . n A 1 29 ILE 29 33 33 ILE ILE A . n A 1 30 ASP 30 34 34 ASP ASP A . n A 1 31 GLN 31 35 35 GLN GLN A . n A 1 32 THR 32 36 36 THR THR A . n A 1 33 THR 33 37 37 THR THR A . n A 1 34 THR 34 38 38 THR THR A . n A 1 35 TRP 35 39 39 TRP TRP A . n A 1 36 GLN 36 40 40 GLN GLN A . n A 1 37 ASP 37 41 41 ASP ASP A . n A 1 38 PRO 38 42 42 PRO PRO A . n A 1 39 ARG 39 43 43 ARG ARG A . n A 1 40 LYS 40 44 44 LYS LYS A . n B 2 1 GLY 1 3 3 GLY GLY B . n B 2 2 PRO 2 4 4 PRO PRO B . n B 2 3 PRO 3 5 5 PRO PRO B . n B 2 4 PRO 4 6 6 PRO PRO B . n B 2 5 TYR 5 7 7 TYR TYR B . n B 2 6 NH2 6 8 8 NH2 NH2 B . n # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id OCT _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 2 _pdbx_nonpoly_scheme.auth_seq_num 2 _pdbx_nonpoly_scheme.pdb_mon_id OCT _pdbx_nonpoly_scheme.auth_mon_id OCT _pdbx_nonpoly_scheme.pdb_strand_id B _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1K9Q _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1K9Q _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1K9Q _struct.title 'YAP65 WW domain complexed to N-(n-octyl)-GPPPY-NH2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K9Q _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'WW domain, YAP65, beta-sheet proteins, ligands, proline-rich peptides, STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP YAP1_HUMAN 1 FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK 165 P46937 ? 2 GB AAD10950 2 PPPPY 149 4205084 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1K9Q A 1 ? 40 ? P46937 165 ? 204 ? 5 44 2 2 1K9Q B 1 ? 5 ? 4205084 149 ? 153 ? 3 7 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 1K9Q GLY B 1 ? GB 4205084 PRO 149 'engineered mutation' 3 1 2 1K9Q NH2 B 6 ? GB 4205084 ? ? amidation 8 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? C OCT . C1 ? ? ? 1_555 B GLY 1 N ? ? B OCT 2 B GLY 3 1_555 ? ? ? ? ? ? ? 1.490 ? ? covale2 covale both ? B TYR 5 C ? ? ? 1_555 B NH2 6 N ? ? B TYR 7 B NH2 8 1_555 ? ? ? ? ? ? ? 1.304 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NH2 B 6 ? TYR B 5 ? NH2 B 8 ? 1_555 TYR B 7 ? 1_555 . . TYR 5 NH2 None 'Terminal amidation' 2 OCT C . ? GLY B 1 ? OCT B 2 ? 1_555 GLY B 3 ? 1_555 C1 N GLY 1 OCT None Lipid/lipid-like # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 13 ? LYS A 17 ? TRP A 17 LYS A 21 A 2 ARG A 23 ? ASN A 27 ? ARG A 27 ASN A 31 A 3 THR A 32 ? THR A 34 ? THR A 36 THR A 38 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 16 ? N ALA A 20 O TYR A 24 ? O TYR A 28 A 2 3 N PHE A 25 ? N PHE A 29 O THR A 34 ? O THR A 38 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id B _struct_site.pdbx_auth_comp_id OCT _struct_site.pdbx_auth_seq_id 2 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE OCT B 2' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id GLY _struct_site_gen.label_asym_id B _struct_site_gen.label_seq_id 1 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id GLY _struct_site_gen.auth_asym_id B _struct_site_gen.auth_seq_id 3 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _pdbx_entry_details.entry_id 1K9Q _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 11 OG A SER 23 ? ? HE21 A GLN 26 ? ? 1.57 2 11 H A ASN 31 ? ? O A THR 36 ? ? 1.58 3 12 H A ASN 31 ? ? O A THR 36 ? ? 1.59 4 16 O A PRO 42 ? ? HH11 A ARG 43 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 7 ? ? -167.65 71.34 2 1 PRO A 12 ? ? -71.88 -159.13 3 1 ALA A 20 ? ? -172.73 149.16 4 1 SER A 23 ? ? -176.11 -154.70 5 1 SER A 24 ? ? -66.68 74.58 6 1 ARG A 27 ? ? -63.97 74.27 7 1 GLN A 35 ? ? 54.94 72.02 8 1 TRP A 39 ? ? -63.70 -160.83 9 1 ASP A 41 ? ? -177.54 -59.90 10 2 GLU A 6 ? ? 54.35 99.21 11 2 LEU A 13 ? ? 54.64 176.96 12 2 SER A 23 ? ? 178.56 -85.68 13 2 SER A 24 ? ? -128.30 -80.52 14 2 ARG A 27 ? ? -64.93 72.41 15 2 GLN A 35 ? ? 53.93 75.30 16 2 TRP A 39 ? ? -109.36 -66.99 17 3 GLU A 6 ? ? -79.19 -72.89 18 3 PRO A 12 ? ? -73.62 -159.59 19 3 SER A 23 ? ? -176.82 59.98 20 3 SER A 24 ? ? 48.09 90.01 21 3 ARG A 27 ? ? -65.16 73.57 22 3 TRP A 39 ? ? -63.54 -149.63 23 3 ASP A 41 ? ? -175.99 -60.13 24 4 ILE A 7 ? ? -52.84 108.45 25 4 ASP A 9 ? ? -113.84 77.63 26 4 ASP A 10 ? ? -174.39 -60.99 27 4 PRO A 12 ? ? -71.62 -87.89 28 4 ALA A 20 ? ? -170.21 145.63 29 4 SER A 23 ? ? -176.43 -151.70 30 4 SER A 24 ? ? -66.55 74.77 31 4 ARG A 27 ? ? -63.98 74.10 32 4 TRP A 39 ? ? -100.38 -64.95 33 4 ARG A 43 ? ? -101.52 78.78 34 5 ASP A 9 ? ? -91.06 41.64 35 5 ASP A 10 ? ? -173.40 83.65 36 5 LEU A 13 ? ? 53.56 -179.30 37 5 ALA A 20 ? ? -171.19 145.66 38 5 SER A 23 ? ? -178.08 -153.65 39 5 ARG A 27 ? ? -65.67 75.41 40 5 GLN A 35 ? ? 54.06 71.07 41 5 TRP A 39 ? ? -106.62 -61.33 42 6 GLU A 6 ? ? -53.67 172.16 43 6 ASP A 10 ? ? -67.39 74.62 44 6 VAL A 11 ? ? 54.16 99.06 45 6 PRO A 12 ? ? -71.69 -158.38 46 6 LEU A 13 ? ? -51.44 177.02 47 6 SER A 23 ? ? -177.89 -153.07 48 6 SER A 24 ? ? -53.73 -70.17 49 6 ARG A 27 ? ? -65.72 69.08 50 6 GLN A 35 ? ? 51.98 78.66 51 6 TRP A 39 ? ? -102.34 -67.14 52 6 GLN A 40 ? ? -58.07 103.07 53 6 ARG A 43 ? ? -81.73 -74.79 54 7 GLU A 6 ? ? -73.33 -159.73 55 7 PRO A 8 ? ? -72.99 -163.51 56 7 VAL A 11 ? ? -175.06 106.89 57 7 PRO A 12 ? ? -71.10 -159.07 58 7 ALA A 20 ? ? -170.82 142.31 59 7 SER A 23 ? ? -178.58 -155.37 60 7 GLN A 35 ? ? 35.75 65.84 61 7 ASP A 41 ? ? -51.87 107.98 62 7 ARG A 43 ? ? -167.94 29.52 63 8 GLU A 6 ? ? -68.24 -161.28 64 8 ILE A 7 ? ? -117.02 68.48 65 8 ASP A 10 ? ? -127.92 -80.49 66 8 PRO A 12 ? ? -72.00 -159.27 67 8 SER A 23 ? ? -179.89 95.69 68 8 SER A 24 ? ? 61.37 -78.28 69 8 GLN A 26 ? ? -58.92 89.86 70 8 GLN A 35 ? ? 55.36 74.75 71 8 GLN A 40 ? ? 50.17 -176.28 72 8 ARG A 43 ? ? -119.15 -78.93 73 9 ILE A 7 ? ? -115.37 72.03 74 9 PRO A 12 ? ? -72.00 -159.46 75 9 SER A 23 ? ? 178.71 -152.66 76 9 SER A 24 ? ? -52.59 -80.69 77 9 GLN A 26 ? ? -69.02 71.23 78 9 ASP A 41 ? ? -176.80 -60.03 79 10 ASP A 9 ? ? -103.23 70.47 80 10 PRO A 12 ? ? -72.99 -85.91 81 10 ALA A 20 ? ? -172.11 146.34 82 10 SER A 23 ? ? -175.58 -154.32 83 10 SER A 24 ? ? -66.65 74.37 84 10 ARG A 27 ? ? -63.91 75.92 85 10 GLN A 35 ? ? 50.36 77.43 86 10 ARG A 43 ? ? -175.02 33.16 87 11 GLU A 6 ? ? -98.08 -68.13 88 11 PRO A 8 ? ? -75.89 -163.23 89 11 ASP A 10 ? ? -73.52 -80.29 90 11 ALA A 20 ? ? -171.28 148.03 91 11 SER A 23 ? ? -157.87 -154.39 92 11 GLN A 35 ? ? 55.49 72.71 93 11 TRP A 39 ? ? -106.84 -64.20 94 12 ASP A 9 ? ? -118.59 52.94 95 12 ASP A 10 ? ? -158.40 -71.73 96 12 ALA A 20 ? ? -171.02 144.82 97 12 SER A 23 ? ? -175.76 58.00 98 12 SER A 24 ? ? 50.13 96.24 99 12 ARG A 27 ? ? -63.45 74.46 100 12 ASP A 41 ? ? 56.22 94.30 101 12 ARG A 43 ? ? 53.24 96.63 102 13 PRO A 8 ? ? -72.46 -166.35 103 13 PRO A 12 ? ? -71.44 -159.48 104 13 LEU A 13 ? ? -51.42 177.51 105 13 SER A 23 ? ? 52.15 95.41 106 13 SER A 24 ? ? 63.35 -77.28 107 13 GLN A 26 ? ? 51.08 74.51 108 13 GLN A 35 ? ? 55.30 70.72 109 13 GLN A 40 ? ? 52.35 -160.48 110 14 GLU A 6 ? ? -174.88 124.84 111 14 PRO A 12 ? ? -71.23 -159.05 112 14 SER A 23 ? ? -177.12 -152.52 113 14 ARG A 27 ? ? -65.86 70.04 114 14 TRP A 39 ? ? -77.99 -149.05 115 14 ASP A 41 ? ? -176.51 -60.06 116 14 ARG A 43 ? ? -151.57 -78.82 117 15 GLU A 6 ? ? -173.79 -156.01 118 15 ASP A 10 ? ? -175.30 -64.72 119 15 PRO A 12 ? ? -71.37 -87.93 120 15 SER A 23 ? ? -163.56 -147.81 121 15 GLN A 26 ? ? -60.69 89.05 122 15 GLN A 35 ? ? 55.11 75.53 123 15 ASP A 41 ? ? 62.63 132.63 124 16 GLU A 6 ? ? -87.41 49.62 125 16 ASP A 10 ? ? -151.07 53.17 126 16 LEU A 13 ? ? 54.05 -177.08 127 16 SER A 23 ? ? 53.82 -139.82 128 16 SER A 24 ? ? -68.29 70.59 129 16 GLN A 26 ? ? -55.92 92.94 130 16 ARG A 27 ? ? -66.72 89.92 131 16 GLN A 40 ? ? -52.35 101.55 132 16 ARG A 43 ? ? -176.87 -75.62 133 17 GLU A 6 ? ? 53.89 -159.14 134 17 PRO A 12 ? ? -73.52 -89.94 135 17 LEU A 13 ? ? -171.42 -165.19 136 17 ALA A 20 ? ? -171.30 144.66 137 17 SER A 23 ? ? -176.27 -157.72 138 17 SER A 24 ? ? -66.87 73.92 139 17 ARG A 27 ? ? -67.20 80.54 140 17 ASP A 34 ? ? -141.48 17.65 141 17 GLN A 35 ? ? 49.43 81.86 142 17 GLN A 40 ? ? -57.97 -165.65 143 18 PRO A 8 ? ? -72.55 -163.39 144 18 ASP A 9 ? ? -105.97 61.12 145 18 ASP A 10 ? ? -153.11 21.75 146 18 PRO A 12 ? ? -72.19 -159.65 147 18 SER A 23 ? ? 55.10 -142.74 148 18 SER A 24 ? ? -50.22 -81.04 149 18 GLN A 26 ? ? -52.68 94.64 150 18 GLN A 35 ? ? 57.38 81.14 151 18 ASP A 41 ? ? -179.77 -59.35 152 18 ARG A 43 ? ? -175.26 67.76 153 19 ASP A 9 ? ? -61.95 84.57 154 19 ASP A 10 ? ? -177.09 -34.13 155 19 LEU A 13 ? ? 57.28 173.20 156 19 SER A 23 ? ? -178.49 -91.61 157 19 GLN A 35 ? ? 54.96 76.68 158 19 TRP A 39 ? ? -103.70 -60.23 159 19 ARG A 43 ? ? -174.83 -56.45 160 20 PRO A 8 ? ? -72.83 -163.14 161 20 ASP A 9 ? ? -156.65 23.38 162 20 LEU A 13 ? ? 58.61 -175.32 163 20 SER A 23 ? ? -177.70 103.34 164 20 GLN A 26 ? ? -59.00 90.12 165 20 ARG A 27 ? ? -63.48 85.23 166 20 GLN A 35 ? ? 55.01 72.75 167 20 GLN A 40 ? ? -51.24 94.50 168 20 ARG A 43 ? ? -151.49 19.82 # _pdbx_nmr_ensemble.entry_id 1K9Q _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1K9Q _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 'phosphate buffer 10mM, NaCl 100mM, DTT 0.1mM, EDTA 0.1mM, pH 6, WW domain 1.2mM, ligand 2.4mM' 'H2O (10% D2O)' 2 'phosphate buffer 10mM, NaCl 100mM, DTT 0.1mM, EDTA 0.1mM, pH 6, WW domain 1.2mM, ligand 2.4mM' D2O # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 288 1 6 '100mM NaCl' atm K 2 288 1 6 '100mM NaCl' atm K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 2 '2D NOESY' # _pdbx_nmr_refine.entry_id 1K9Q _pdbx_nmr_refine.method 'Simulated anneling' _pdbx_nmr_refine.details '2000K, 200 runs, Force constants for NOE 50kcal mol-1 rad-2, 422 restraints' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 processing Bruker 1 ANSIG 3.3 'data analysis' 'Kraulis, P.J.' 2 X-PLOR 3.1 refinement 'Brunger, A.T.' 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 NH2 N N N N 233 NH2 HN1 H N N 234 NH2 HN2 H N N 235 OCT C1 C N N 236 OCT C2 C N N 237 OCT C3 C N N 238 OCT C4 C N N 239 OCT C5 C N N 240 OCT C6 C N N 241 OCT C7 C N N 242 OCT C8 C N N 243 OCT H11 H N N 244 OCT H12 H N N 245 OCT H13 H N N 246 OCT H21 H N N 247 OCT H22 H N N 248 OCT H31 H N N 249 OCT H32 H N N 250 OCT H41 H N N 251 OCT H42 H N N 252 OCT H51 H N N 253 OCT H52 H N N 254 OCT H61 H N N 255 OCT H62 H N N 256 OCT H71 H N N 257 OCT H72 H N N 258 OCT H81 H N N 259 OCT H82 H N N 260 OCT H83 H N N 261 PHE N N N N 262 PHE CA C N S 263 PHE C C N N 264 PHE O O N N 265 PHE CB C N N 266 PHE CG C Y N 267 PHE CD1 C Y N 268 PHE CD2 C Y N 269 PHE CE1 C Y N 270 PHE CE2 C Y N 271 PHE CZ C Y N 272 PHE OXT O N N 273 PHE H H N N 274 PHE H2 H N N 275 PHE HA H N N 276 PHE HB2 H N N 277 PHE HB3 H N N 278 PHE HD1 H N N 279 PHE HD2 H N N 280 PHE HE1 H N N 281 PHE HE2 H N N 282 PHE HZ H N N 283 PHE HXT H N N 284 PRO N N N N 285 PRO CA C N S 286 PRO C C N N 287 PRO O O N N 288 PRO CB C N N 289 PRO CG C N N 290 PRO CD C N N 291 PRO OXT O N N 292 PRO H H N N 293 PRO HA H N N 294 PRO HB2 H N N 295 PRO HB3 H N N 296 PRO HG2 H N N 297 PRO HG3 H N N 298 PRO HD2 H N N 299 PRO HD3 H N N 300 PRO HXT H N N 301 SER N N N N 302 SER CA C N S 303 SER C C N N 304 SER O O N N 305 SER CB C N N 306 SER OG O N N 307 SER OXT O N N 308 SER H H N N 309 SER H2 H N N 310 SER HA H N N 311 SER HB2 H N N 312 SER HB3 H N N 313 SER HG H N N 314 SER HXT H N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TRP N N N N 333 TRP CA C N S 334 TRP C C N N 335 TRP O O N N 336 TRP CB C N N 337 TRP CG C Y N 338 TRP CD1 C Y N 339 TRP CD2 C Y N 340 TRP NE1 N Y N 341 TRP CE2 C Y N 342 TRP CE3 C Y N 343 TRP CZ2 C Y N 344 TRP CZ3 C Y N 345 TRP CH2 C Y N 346 TRP OXT O N N 347 TRP H H N N 348 TRP H2 H N N 349 TRP HA H N N 350 TRP HB2 H N N 351 TRP HB3 H N N 352 TRP HD1 H N N 353 TRP HE1 H N N 354 TRP HE3 H N N 355 TRP HZ2 H N N 356 TRP HZ3 H N N 357 TRP HH2 H N N 358 TRP HXT H N N 359 TYR N N N N 360 TYR CA C N S 361 TYR C C N N 362 TYR O O N N 363 TYR CB C N N 364 TYR CG C Y N 365 TYR CD1 C Y N 366 TYR CD2 C Y N 367 TYR CE1 C Y N 368 TYR CE2 C Y N 369 TYR CZ C Y N 370 TYR OH O N N 371 TYR OXT O N N 372 TYR H H N N 373 TYR H2 H N N 374 TYR HA H N N 375 TYR HB2 H N N 376 TYR HB3 H N N 377 TYR HD1 H N N 378 TYR HD2 H N N 379 TYR HE1 H N N 380 TYR HE2 H N N 381 TYR HH H N N 382 TYR HXT H N N 383 VAL N N N N 384 VAL CA C N S 385 VAL C C N N 386 VAL O O N N 387 VAL CB C N N 388 VAL CG1 C N N 389 VAL CG2 C N N 390 VAL OXT O N N 391 VAL H H N N 392 VAL H2 H N N 393 VAL HA H N N 394 VAL HB H N N 395 VAL HG11 H N N 396 VAL HG12 H N N 397 VAL HG13 H N N 398 VAL HG21 H N N 399 VAL HG22 H N N 400 VAL HG23 H N N 401 VAL HXT H N N 402 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 NH2 N HN1 sing N N 222 NH2 N HN2 sing N N 223 OCT C1 C2 sing N N 224 OCT C1 H11 sing N N 225 OCT C1 H12 sing N N 226 OCT C1 H13 sing N N 227 OCT C2 C3 sing N N 228 OCT C2 H21 sing N N 229 OCT C2 H22 sing N N 230 OCT C3 C4 sing N N 231 OCT C3 H31 sing N N 232 OCT C3 H32 sing N N 233 OCT C4 C5 sing N N 234 OCT C4 H41 sing N N 235 OCT C4 H42 sing N N 236 OCT C5 C6 sing N N 237 OCT C5 H51 sing N N 238 OCT C5 H52 sing N N 239 OCT C6 C7 sing N N 240 OCT C6 H61 sing N N 241 OCT C6 H62 sing N N 242 OCT C7 C8 sing N N 243 OCT C7 H71 sing N N 244 OCT C7 H72 sing N N 245 OCT C8 H81 sing N N 246 OCT C8 H82 sing N N 247 OCT C8 H83 sing N N 248 PHE N CA sing N N 249 PHE N H sing N N 250 PHE N H2 sing N N 251 PHE CA C sing N N 252 PHE CA CB sing N N 253 PHE CA HA sing N N 254 PHE C O doub N N 255 PHE C OXT sing N N 256 PHE CB CG sing N N 257 PHE CB HB2 sing N N 258 PHE CB HB3 sing N N 259 PHE CG CD1 doub Y N 260 PHE CG CD2 sing Y N 261 PHE CD1 CE1 sing Y N 262 PHE CD1 HD1 sing N N 263 PHE CD2 CE2 doub Y N 264 PHE CD2 HD2 sing N N 265 PHE CE1 CZ doub Y N 266 PHE CE1 HE1 sing N N 267 PHE CE2 CZ sing Y N 268 PHE CE2 HE2 sing N N 269 PHE CZ HZ sing N N 270 PHE OXT HXT sing N N 271 PRO N CA sing N N 272 PRO N CD sing N N 273 PRO N H sing N N 274 PRO CA C sing N N 275 PRO CA CB sing N N 276 PRO CA HA sing N N 277 PRO C O doub N N 278 PRO C OXT sing N N 279 PRO CB CG sing N N 280 PRO CB HB2 sing N N 281 PRO CB HB3 sing N N 282 PRO CG CD sing N N 283 PRO CG HG2 sing N N 284 PRO CG HG3 sing N N 285 PRO CD HD2 sing N N 286 PRO CD HD3 sing N N 287 PRO OXT HXT sing N N 288 SER N CA sing N N 289 SER N H sing N N 290 SER N H2 sing N N 291 SER CA C sing N N 292 SER CA CB sing N N 293 SER CA HA sing N N 294 SER C O doub N N 295 SER C OXT sing N N 296 SER CB OG sing N N 297 SER CB HB2 sing N N 298 SER CB HB3 sing N N 299 SER OG HG sing N N 300 SER OXT HXT sing N N 301 THR N CA sing N N 302 THR N H sing N N 303 THR N H2 sing N N 304 THR CA C sing N N 305 THR CA CB sing N N 306 THR CA HA sing N N 307 THR C O doub N N 308 THR C OXT sing N N 309 THR CB OG1 sing N N 310 THR CB CG2 sing N N 311 THR CB HB sing N N 312 THR OG1 HG1 sing N N 313 THR CG2 HG21 sing N N 314 THR CG2 HG22 sing N N 315 THR CG2 HG23 sing N N 316 THR OXT HXT sing N N 317 TRP N CA sing N N 318 TRP N H sing N N 319 TRP N H2 sing N N 320 TRP CA C sing N N 321 TRP CA CB sing N N 322 TRP CA HA sing N N 323 TRP C O doub N N 324 TRP C OXT sing N N 325 TRP CB CG sing N N 326 TRP CB HB2 sing N N 327 TRP CB HB3 sing N N 328 TRP CG CD1 doub Y N 329 TRP CG CD2 sing Y N 330 TRP CD1 NE1 sing Y N 331 TRP CD1 HD1 sing N N 332 TRP CD2 CE2 doub Y N 333 TRP CD2 CE3 sing Y N 334 TRP NE1 CE2 sing Y N 335 TRP NE1 HE1 sing N N 336 TRP CE2 CZ2 sing Y N 337 TRP CE3 CZ3 doub Y N 338 TRP CE3 HE3 sing N N 339 TRP CZ2 CH2 doub Y N 340 TRP CZ2 HZ2 sing N N 341 TRP CZ3 CH2 sing Y N 342 TRP CZ3 HZ3 sing N N 343 TRP CH2 HH2 sing N N 344 TRP OXT HXT sing N N 345 TYR N CA sing N N 346 TYR N H sing N N 347 TYR N H2 sing N N 348 TYR CA C sing N N 349 TYR CA CB sing N N 350 TYR CA HA sing N N 351 TYR C O doub N N 352 TYR C OXT sing N N 353 TYR CB CG sing N N 354 TYR CB HB2 sing N N 355 TYR CB HB3 sing N N 356 TYR CG CD1 doub Y N 357 TYR CG CD2 sing Y N 358 TYR CD1 CE1 sing Y N 359 TYR CD1 HD1 sing N N 360 TYR CD2 CE2 doub Y N 361 TYR CD2 HD2 sing N N 362 TYR CE1 CZ doub Y N 363 TYR CE1 HE1 sing N N 364 TYR CE2 CZ sing Y N 365 TYR CE2 HE2 sing N N 366 TYR CZ OH sing N N 367 TYR OH HH sing N N 368 TYR OXT HXT sing N N 369 VAL N CA sing N N 370 VAL N H sing N N 371 VAL N H2 sing N N 372 VAL CA C sing N N 373 VAL CA CB sing N N 374 VAL CA HA sing N N 375 VAL C O doub N N 376 VAL C OXT sing N N 377 VAL CB CG1 sing N N 378 VAL CB CG2 sing N N 379 VAL CB HB sing N N 380 VAL CG1 HG11 sing N N 381 VAL CG1 HG12 sing N N 382 VAL CG1 HG13 sing N N 383 VAL CG2 HG21 sing N N 384 VAL CG2 HG22 sing N N 385 VAL CG2 HG23 sing N N 386 VAL OXT HXT sing N N 387 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DMX 750 # _atom_sites.entry_id 1K9Q _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_