data_1KCY # _entry.id 1KCY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KCY pdb_00001kcy 10.2210/pdb1kcy/pdb RCSB RCSB014823 ? ? WWPDB D_1000014823 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1CLB _pdbx_database_related.details ;1CLB is the structure of Apo P43G calbindin D9k. P43G is essentially "wildtype", and is very similar to the P43M mutation used as a background for the F36G mutation. ; _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KCY _pdbx_database_status.recvd_initial_deposition_date 2001-11-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nelson, M.R.' 1 'Thulin, E.' 2 'Fagan, P.A.' 3 'Forsen, S.' 4 'Chazin, W.J.' 5 # _citation.id primary _citation.title 'The EF-hand domain: a globally cooperative structural unit.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 11 _citation.page_first 198 _citation.page_last 205 _citation.year 2002 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11790829 _citation.pdbx_database_id_DOI 10.1110/ps.33302 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nelson, M.R.' 1 ? primary 'Thulin, E.' 2 ? primary 'Fagan, P.A.' 3 ? primary 'Forsen, S.' 4 ? primary 'Chazin, W.J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'calbindin D9k' _entity.formula_weight 8454.515 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'F36G, P43M' _entity.pdbx_fragment 'contains EF-HAND 1 (LOW AFFINITY) and EF-HAND 2 (HIGH AFFINITY)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CABP, Vitamin D-dependent calcium-binding protein, intestinal' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEGPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _entity_poly.pdbx_seq_one_letter_code_can KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEGPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 SER n 1 3 PRO n 1 4 GLU n 1 5 GLU n 1 6 LEU n 1 7 LYS n 1 8 GLY n 1 9 ILE n 1 10 PHE n 1 11 GLU n 1 12 LYS n 1 13 TYR n 1 14 ALA n 1 15 ALA n 1 16 LYS n 1 17 GLU n 1 18 GLY n 1 19 ASP n 1 20 PRO n 1 21 ASN n 1 22 GLN n 1 23 LEU n 1 24 SER n 1 25 LYS n 1 26 GLU n 1 27 GLU n 1 28 LEU n 1 29 LYS n 1 30 LEU n 1 31 LEU n 1 32 LEU n 1 33 GLN n 1 34 THR n 1 35 GLU n 1 36 GLY n 1 37 PRO n 1 38 SER n 1 39 LEU n 1 40 LEU n 1 41 LYS n 1 42 GLY n 1 43 MET n 1 44 SER n 1 45 THR n 1 46 LEU n 1 47 ASP n 1 48 GLU n 1 49 LEU n 1 50 PHE n 1 51 GLU n 1 52 GLU n 1 53 LEU n 1 54 ASP n 1 55 LYS n 1 56 ASN n 1 57 GLY n 1 58 ASP n 1 59 GLY n 1 60 GLU n 1 61 VAL n 1 62 SER n 1 63 PHE n 1 64 GLU n 1 65 GLU n 1 66 PHE n 1 67 GLN n 1 68 VAL n 1 69 LEU n 1 70 VAL n 1 71 LYS n 1 72 LYS n 1 73 ILE n 1 74 SER n 1 75 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pRCB1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100G_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _struct_ref.pdbx_align_begin 4 _struct_ref.pdbx_db_accession P02633 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KCY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02633 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KCY GLY A 36 ? UNP P02633 PHE 39 'engineered mutation' 36 1 1 1KCY MET A 43 ? UNP P02633 PRO 46 'engineered mutation' 43 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 2D_COSY 2 1 1 2D_NOESY 3 1 1 2D_TOCSY 4 3 1 2D_NOESY 5 2 1 2D_15N-1H_HSQC 6 2 1 3D_15N-separated_TOCSY 7 2 1 3D_15N-separated_NOESY 8 2 1 HNHA 9 2 1 HNHB # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'no added salts' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2.5 mM calbindin; 95% H2O; 5% D2O' '95% H20; 5% D2O' 2 '2.5 mM calbindin D9k U-15N; 95% H2O; 5% D2O' '95% H2O/5% D2O' 3 '2.5 mM calbindin D9k; 100% D20' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AMX 500 2 ? Bruker DMX 750 # _pdbx_nmr_refine.entry_id 1KCY _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ;The structures are based on 1042 NOE restraints (186 intraresidue, 269 sequential, 289 medium range (2-4 residues apart), 298 long range), 18 hydrogen bond restraints (assigned as described in Skelton et al., 1995), and 115 dihedral constraints (45 phi, 42 psi, and 28 chi1). ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1KCY _pdbx_nmr_details.text 'This structure was determined using a combination of standard 2D homonuclear and 15N-based 3D methods.' # _pdbx_nmr_ensemble.entry_id 1KCY _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 22 _pdbx_nmr_ensemble.conformer_selection_criteria ;The full ensemble was ordered by lowest residual constraint violations, then the top 22 with favorable covalent geometries and AMBER energies were selected ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1KCY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DIANA 2.8 'structure solution' Guntert 1 Amber 4.1 'structure solution' Pearlmann 2 Felix 97 'data analysis' 'Molecular Simulations, Inc.' 3 GLOMSA unknown 'data analysis' Guntert 4 GENXPK 1 'data analysis' Gippert 5 Amber 4.1 refinement Pearlmann 6 # _exptl.entry_id 1KCY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1KCY _struct.title 'NMR solution structure of apo calbindin D9k (F36G + P43M mutant)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KCY _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'EF HAND, CALCIUM-BINDING PROTEIN, STRUCTURE PERTURBING MUTATION, FOUR HELIX BUNDLE, METAL BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 1 ? GLU A 17 ? LYS A 1 GLU A 17 1 ? 17 HELX_P HELX_P2 2 LYS A 25 ? LEU A 40 ? LYS A 25 LEU A 40 1 ? 16 HELX_P HELX_P3 3 SER A 44 ? GLY A 57 ? SER A 44 GLY A 57 1 ? 14 HELX_P HELX_P4 4 PHE A 63 ? GLN A 75 ? PHE A 63 GLN A 75 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 22 ? SER A 24 ? GLN A 22 SER A 24 A 2 GLU A 60 ? SER A 62 ? GLU A 60 SER A 62 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 23 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 61 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 61 # _database_PDB_matrix.entry_id 1KCY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KCY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLN 75 75 75 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-11-21 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE P43M is the background mutation used in the Chazin lab to study all calbindin D9k mutants. This mutation removes spectra-complicating cis-trans isomerization at Pro43 but does not otherwise affect the structure. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 25 ? ? -26.34 -54.50 2 1 LYS A 41 ? ? -141.45 28.54 3 1 SER A 44 ? ? -145.08 -121.94 4 2 LYS A 25 ? ? -24.09 -65.99 5 2 SER A 44 ? ? 175.21 -155.43 6 2 ASP A 54 ? ? -29.97 -47.95 7 3 GLU A 17 ? ? -79.97 27.25 8 3 LYS A 25 ? ? -20.11 -55.82 9 3 LEU A 31 ? ? -68.91 -79.44 10 3 LEU A 32 ? ? -21.68 -60.37 11 3 GLN A 33 ? ? -24.85 -54.80 12 3 THR A 34 ? ? -24.56 -62.32 13 3 SER A 44 ? ? -134.25 -79.34 14 3 GLU A 60 ? ? 48.47 76.32 15 4 LYS A 25 ? ? 0.88 -78.71 16 4 LEU A 39 ? ? -146.33 25.36 17 4 MET A 43 ? ? 42.59 -131.66 18 4 SER A 44 ? ? 48.03 -147.96 19 5 MET A 43 ? ? 40.45 -117.52 20 5 SER A 44 ? ? 26.50 -126.08 21 6 SER A 38 ? ? -101.47 -61.25 22 6 SER A 44 ? ? -146.10 -142.51 23 6 THR A 45 ? ? -27.68 -59.84 24 7 LYS A 25 ? ? -19.98 -65.74 25 7 SER A 44 ? ? -169.82 -169.03 26 8 GLU A 17 ? ? -75.51 45.63 27 8 LYS A 25 ? ? -29.32 -59.59 28 8 SER A 44 ? ? -171.23 -82.51 29 9 LYS A 25 ? ? -23.85 -62.96 30 9 MET A 43 ? ? 17.47 -82.86 31 9 SER A 44 ? ? 18.81 -107.61 32 10 SER A 44 ? ? -146.76 -138.42 33 11 LYS A 25 ? ? -18.49 -62.33 34 11 SER A 44 ? ? -94.64 -81.61 35 11 ASP A 58 ? ? 68.98 -63.95 36 11 GLU A 60 ? ? -150.46 84.27 37 12 LYS A 25 ? ? -18.77 -73.55 38 12 LEU A 39 ? ? -142.05 13.09 39 12 MET A 43 ? ? 48.07 -90.49 40 12 SER A 44 ? ? 9.14 -94.43 41 13 LYS A 25 ? ? -24.39 -62.57 42 13 SER A 44 ? ? -178.30 -151.42 43 14 LEU A 39 ? ? -144.98 14.44 44 14 MET A 43 ? ? 68.28 -77.05 45 14 SER A 44 ? ? 7.92 -100.78 46 15 LYS A 25 ? ? -25.08 -61.11 47 15 SER A 44 ? ? -148.23 -137.82 48 16 LYS A 25 ? ? -22.60 -63.97 49 16 LYS A 41 ? ? -144.46 45.88 50 16 MET A 43 ? ? -66.79 85.56 51 16 SER A 44 ? ? -155.28 -138.00 52 17 LYS A 25 ? ? -27.41 -53.84 53 17 LEU A 39 ? ? -145.39 32.70 54 17 SER A 44 ? ? -54.41 103.62 55 17 THR A 45 ? ? 75.25 -49.90 56 17 ASP A 54 ? ? -39.12 -37.42 57 18 LYS A 25 ? ? -18.81 -65.13 58 18 SER A 44 ? ? -136.36 -143.31 59 19 LYS A 25 ? ? -25.62 -60.61 60 19 LYS A 41 ? ? -144.89 35.60 61 19 MET A 43 ? ? 64.17 -74.25 62 19 SER A 44 ? ? -33.88 102.28 63 19 THR A 45 ? ? 73.09 -51.25 64 20 LYS A 25 ? ? -20.83 -62.33 65 20 SER A 44 ? ? -127.98 -53.98 66 20 THR A 45 ? ? -140.87 -51.82 67 21 LYS A 25 ? ? -29.56 -58.17 68 21 LEU A 39 ? ? -144.79 31.81 69 21 LYS A 41 ? ? -140.93 39.84 70 21 SER A 44 ? ? -146.22 -137.37 71 22 LYS A 25 ? ? -22.45 -63.51 72 22 LYS A 41 ? ? 46.85 71.22 73 22 MET A 43 ? ? -68.84 85.94 74 22 SER A 44 ? ? -158.42 -149.73 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 50 ? ? 0.123 'SIDE CHAIN' 2 1 PHE A 63 ? ? 0.073 'SIDE CHAIN' 3 3 PHE A 50 ? ? 0.136 'SIDE CHAIN' 4 3 PHE A 63 ? ? 0.091 'SIDE CHAIN' 5 4 PHE A 50 ? ? 0.096 'SIDE CHAIN' 6 6 PHE A 50 ? ? 0.195 'SIDE CHAIN' 7 7 PHE A 50 ? ? 0.151 'SIDE CHAIN' 8 7 PHE A 63 ? ? 0.084 'SIDE CHAIN' 9 8 PHE A 50 ? ? 0.120 'SIDE CHAIN' 10 8 PHE A 63 ? ? 0.099 'SIDE CHAIN' 11 9 PHE A 50 ? ? 0.085 'SIDE CHAIN' 12 10 PHE A 50 ? ? 0.136 'SIDE CHAIN' 13 11 PHE A 63 ? ? 0.082 'SIDE CHAIN' 14 12 PHE A 63 ? ? 0.082 'SIDE CHAIN' 15 13 PHE A 50 ? ? 0.166 'SIDE CHAIN' 16 14 PHE A 50 ? ? 0.092 'SIDE CHAIN' 17 15 PHE A 50 ? ? 0.123 'SIDE CHAIN' 18 15 PHE A 63 ? ? 0.081 'SIDE CHAIN' 19 16 PHE A 50 ? ? 0.109 'SIDE CHAIN' 20 16 PHE A 63 ? ? 0.087 'SIDE CHAIN' 21 17 PHE A 50 ? ? 0.098 'SIDE CHAIN' 22 17 PHE A 63 ? ? 0.083 'SIDE CHAIN' 23 17 PHE A 66 ? ? 0.093 'SIDE CHAIN' 24 18 PHE A 50 ? ? 0.101 'SIDE CHAIN' 25 18 PHE A 63 ? ? 0.082 'SIDE CHAIN' 26 18 PHE A 66 ? ? 0.082 'SIDE CHAIN' 27 20 PHE A 50 ? ? 0.092 'SIDE CHAIN' 28 20 PHE A 63 ? ? 0.077 'SIDE CHAIN' 29 21 PHE A 50 ? ? 0.106 'SIDE CHAIN' 30 21 PHE A 63 ? ? 0.082 'SIDE CHAIN' 31 22 PHE A 50 ? ? 0.118 'SIDE CHAIN' #