data_1KEF # _entry.id 1KEF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KEF pdb_00001kef 10.2210/pdb1kef/pdb RCSB RCSB014866 ? ? WWPDB D_1000014866 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KEF _pdbx_database_status.recvd_initial_deposition_date 2001-11-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Piserchio, A.' 1 'Pellegrini, M.' 2 'Mehta, S.' 3 'Blackman, S.M.' 4 'Garcia, E.P.' 5 'Marshall, J.' 6 'Mierke, D.F.' 7 # _citation.id primary _citation.title 'The PDZ1 domain of SAP90. Characterization of structure and binding.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 277 _citation.page_first 6967 _citation.page_last 6973 _citation.year 2002 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11744724 _citation.pdbx_database_id_DOI 10.1074/jbc.M109453200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Piserchio, A.' 1 ? primary 'Pellegrini, M.' 2 ? primary 'Mehta, S.' 3 ? primary 'Blackman, S.M.' 4 ? primary 'Garcia, E.P.' 5 ? primary 'Marshall, J.' 6 ? primary 'Mierke, D.F.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'synapse associated protein-90' _entity.formula_weight 10031.256 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PDZ1 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name '(SAP90), presynaptic density protein 95, PSD-95' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAG SIVRLYVMRRKPP ; _entity_poly.pdbx_seq_one_letter_code_can ;EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAG SIVRLYVMRRKPP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 TYR n 1 3 GLU n 1 4 GLU n 1 5 ILE n 1 6 THR n 1 7 LEU n 1 8 GLU n 1 9 ARG n 1 10 GLY n 1 11 ASN n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 GLY n 1 16 PHE n 1 17 SER n 1 18 ILE n 1 19 ALA n 1 20 GLY n 1 21 GLY n 1 22 THR n 1 23 ASP n 1 24 ASN n 1 25 PRO n 1 26 HIS n 1 27 ILE n 1 28 GLY n 1 29 ASP n 1 30 ASP n 1 31 PRO n 1 32 SER n 1 33 ILE n 1 34 PHE n 1 35 ILE n 1 36 THR n 1 37 LYS n 1 38 ILE n 1 39 ILE n 1 40 PRO n 1 41 GLY n 1 42 GLY n 1 43 ALA n 1 44 ALA n 1 45 ALA n 1 46 GLN n 1 47 ASP n 1 48 GLY n 1 49 ARG n 1 50 LEU n 1 51 ARG n 1 52 VAL n 1 53 ASN n 1 54 ASP n 1 55 SER n 1 56 ILE n 1 57 LEU n 1 58 PHE n 1 59 VAL n 1 60 ASN n 1 61 GLU n 1 62 VAL n 1 63 ASP n 1 64 VAL n 1 65 ARG n 1 66 GLU n 1 67 VAL n 1 68 THR n 1 69 HIS n 1 70 SER n 1 71 ALA n 1 72 ALA n 1 73 VAL n 1 74 GLU n 1 75 ALA n 1 76 LEU n 1 77 LYS n 1 78 GLU n 1 79 ALA n 1 80 GLY n 1 81 SER n 1 82 ILE n 1 83 VAL n 1 84 ARG n 1 85 LEU n 1 86 TYR n 1 87 VAL n 1 88 MET n 1 89 ARG n 1 90 ARG n 1 91 LYS n 1 92 PRO n 1 93 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DLG4_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAG SIVRLYVMRRKPP ; _struct_ref.pdbx_align_begin 105 _struct_ref.pdbx_db_accession P78352 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KEF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P78352 _struct_ref_seq.db_align_beg 105 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '150 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0 mM protein, 10 mM phosphate buffer, 150 mM NaCl, pH 6.8' _pdbx_nmr_sample_details.solvent_system '10 mM phosphate buffer, 150 mM NaCl' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1KEF _pdbx_nmr_refine.method 'simulated annealing with torsion angle restraints' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1KEF _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'average structure from ensemble of 28 structures, chosen by energy and penalty function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1KEF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 3.0 'data analysis' 'Delaglio F.' 1 X-PLOR CNS refinement 'Bruenger, A.' 2 # _exptl.entry_id 1KEF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1KEF _struct.title 'PDZ1 of SAP90' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KEF _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'beta-sheet, anti-parallel beta-sandwich, GLGF loop, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 43 ? GLY A 48 ? ALA A 43 GLY A 48 1 ? 6 HELX_P HELX_P2 2 THR A 68 ? GLY A 80 ? THR A 68 GLY A 80 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 3 ? LEU A 7 ? GLU A 3 LEU A 7 A 2 VAL A 83 ? VAL A 87 ? VAL A 83 VAL A 87 B 1 PHE A 16 ? ALA A 19 ? PHE A 16 ALA A 19 B 2 ILE A 33 ? ILE A 38 ? ILE A 33 ILE A 38 B 3 SER A 55 ? ILE A 56 ? SER A 55 ILE A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 7 ? N LEU A 7 O VAL A 83 ? O VAL A 83 B 1 2 N SER A 17 ? N SER A 17 O THR A 36 ? O THR A 36 B 2 3 N ILE A 33 ? N ILE A 33 O ILE A 56 ? O ILE A 56 # _database_PDB_matrix.entry_id 1KEF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KEF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 PRO 93 93 93 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-03-06 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 69 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 69 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.412 _pdbx_validate_rmsd_bond.bond_target_value 1.354 _pdbx_validate_rmsd_bond.bond_deviation 0.058 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.009 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 123.98 120.30 3.68 0.50 N 2 1 ND1 A HIS 26 ? ? CE1 A HIS 26 ? ? NE2 A HIS 26 ? ? 119.52 111.50 8.02 1.30 N 3 1 NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.25 120.30 3.95 0.50 N 4 1 NE A ARG 51 ? ? CZ A ARG 51 ? ? NH1 A ARG 51 ? ? 124.27 120.30 3.97 0.50 N 5 1 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 124.41 120.30 4.11 0.50 N 6 1 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH2 A ARG 65 ? ? 117.06 120.30 -3.24 0.50 N 7 1 ND1 A HIS 69 ? ? CE1 A HIS 69 ? ? NE2 A HIS 69 ? ? 119.95 111.50 8.45 1.30 N 8 1 NE A ARG 84 ? ? CZ A ARG 84 ? ? NH1 A ARG 84 ? ? 123.71 120.30 3.41 0.50 N 9 1 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH1 A ARG 89 ? ? 123.94 120.30 3.64 0.50 N 10 1 NE A ARG 90 ? ? CZ A ARG 90 ? ? NH1 A ARG 90 ? ? 124.07 120.30 3.77 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 12 ? ? 70.21 -139.58 2 1 LEU A 14 ? ? -121.55 -72.19 3 1 ASP A 23 ? ? -123.65 -53.94 4 1 PRO A 25 ? ? -60.31 90.98 5 1 ASP A 29 ? ? -158.97 -62.24 6 1 THR A 36 ? ? -103.43 -72.05 7 1 ALA A 43 ? ? 175.95 -43.92 8 1 ARG A 49 ? ? -144.07 -35.34 9 1 PHE A 58 ? ? -162.92 73.76 10 1 ASN A 60 ? ? 66.57 -144.17 11 1 GLU A 61 ? ? -94.68 59.50 12 1 ARG A 65 ? ? -179.15 -49.67 13 1 LYS A 91 ? ? -148.50 -63.97 #