data_1KIO # _entry.id 1KIO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KIO pdb_00001kio 10.2210/pdb1kio/pdb RCSB RCSB014996 ? ? WWPDB D_1000014996 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1KGM 'SOLUTION STRUCTURE OF THE SMALL SERINE PROTEASE INHIBITOR SGCI' unspecified PDB 1PMC 'PROTEINASE INHIBITOR PMP-C (NMR, 36 STRUCTURES)' unspecified PDB 1KJ0 'SOLUTION STRUCTURE OF THE SMALL SERINE PROTEASE INHIBITOR SGTI' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KIO _pdbx_database_status.recvd_initial_deposition_date 2001-12-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gaspari, Z.' 1 'Patthy, A.' 2 'Graf, L.' 3 'Perczel, A.' 4 # _citation.id primary _citation.title 'Comparative structure analysis of proteinase inhibitors from the desert locust, Schistocerca gregaria.' _citation.journal_abbrev Eur.J.Biochem. _citation.journal_volume 269 _citation.page_first 527 _citation.page_last 537 _citation.year 2002 _citation.journal_id_ASTM EJBCAI _citation.country IX _citation.journal_id_ISSN 0014-2956 _citation.journal_id_CSD 0262 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11856311 _citation.pdbx_database_id_DOI 10.1046/j.0014-2956.2001.02685.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gaspari, Z.' 1 ? primary 'Patthy, A.' 2 ? primary 'Graf, L.' 3 ? primary 'Perczel, A.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'SERINE PROTEASE INHIBITOR I' _entity.formula_weight 3705.227 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation L30R,K31M _entity.pdbx_fragment 'Residues 57-91' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Schistocerca gregaria chymotrypsin inhibitor (SGCI)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EVTCEPGTTFKDKCNTCRCGSDGKSAACTRMACPQ _entity_poly.pdbx_seq_one_letter_code_can EVTCEPGTTFKDKCNTCRCGSDGKSAACTRMACPQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 VAL n 1 3 THR n 1 4 CYS n 1 5 GLU n 1 6 PRO n 1 7 GLY n 1 8 THR n 1 9 THR n 1 10 PHE n 1 11 LYS n 1 12 ASP n 1 13 LYS n 1 14 CYS n 1 15 ASN n 1 16 THR n 1 17 CYS n 1 18 ARG n 1 19 CYS n 1 20 GLY n 1 21 SER n 1 22 ASP n 1 23 GLY n 1 24 LYS n 1 25 SER n 1 26 ALA n 1 27 ALA n 1 28 CYS n 1 29 THR n 1 30 ARG n 1 31 MET n 1 32 ALA n 1 33 CYS n 1 34 PRO n 1 35 GLN n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'Solid phase peptide synthesis, Fmoc strategy, Sequence naturally found in Schistocerca gregaria (desert locust)' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SGP1_SCHGR _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKLALALCAAFLLVVLVQAEQECTPGQTKKQDCNTCNCTPTGVWACTRKGCPPHKREVTCEPGTTFKDKCNTCRCGSDGK SAACTLKACPQK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession O46162 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KIO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O46162 _struct_ref_seq.db_align_beg 57 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 91 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KIO ARG A 30 ? UNP O46162 LEU 86 'engineered mutation' 30 1 1 1KIO MET A 31 ? UNP O46162 LYS 87 'engineered mutation' 31 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 292 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 3.03 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.8mM SGCI[L30R, K31M] NA' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1KIO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'the structures are based on a total of 526 NMR distance restraints (150 long-range)' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1KIO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1KIO _pdbx_nmr_representative.conformer_id 3 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.851 refinement Brunger 1 X-PLOR 3.851 'structure solution' Brunger 2 # _exptl.entry_id 1KIO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1KIO _struct.title 'SOLUTION STRUCTURE OF THE SMALL SERINE PROTEASE INHIBITOR SGCI[L30R, K31M]' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KIO _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'specificity, protease inhibitor, modified specificity, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 4 A CYS 19 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 14 A CYS 33 1_555 ? ? ? ? ? ? ? 2.016 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 17 A CYS 28 1_555 ? ? ? ? ? ? ? 2.022 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 8 ? THR A 9 ? THR A 8 THR A 9 A 2 ARG A 18 ? CYS A 19 ? ARG A 18 CYS A 19 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 8 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 8 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id CYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 19 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 19 # _database_PDB_matrix.entry_id 1KIO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KIO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLN 35 35 35 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-12-12 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 O A PHE 10 ? ? H A CYS 17 ? ? 1.55 2 7 H A GLY 20 ? ? O A SER 25 ? ? 1.50 3 8 H A GLY 7 ? ? O A CYS 19 ? ? 1.59 4 10 H A GLY 7 ? ? O A CYS 19 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 13 ? ? 45.83 -135.63 2 1 THR A 16 ? ? -51.53 179.12 3 1 CYS A 17 ? ? -168.75 88.24 4 1 ARG A 18 ? ? -68.00 98.21 5 1 SER A 25 ? ? -170.23 116.35 6 1 CYS A 28 ? ? 63.78 136.78 7 1 ARG A 30 ? ? -155.37 -156.83 8 2 THR A 8 ? ? -165.39 -33.79 9 2 THR A 9 ? ? 51.53 165.57 10 2 PHE A 10 ? ? 176.46 168.95 11 2 LYS A 13 ? ? 48.33 -102.97 12 2 THR A 16 ? ? -52.64 -174.62 13 2 CYS A 17 ? ? 174.85 95.43 14 2 LYS A 24 ? ? 170.59 41.35 15 2 SER A 25 ? ? -172.63 100.32 16 2 ALA A 26 ? ? -104.63 -150.46 17 2 ALA A 27 ? ? -147.28 -39.38 18 2 CYS A 28 ? ? 63.69 134.36 19 3 THR A 3 ? ? 176.60 25.53 20 3 ASP A 12 ? ? -98.90 -82.69 21 3 LYS A 13 ? ? -68.20 -102.41 22 3 THR A 16 ? ? -76.00 -166.18 23 3 CYS A 17 ? ? 174.38 107.68 24 3 LYS A 24 ? ? -149.98 43.16 25 3 SER A 25 ? ? -172.06 109.72 26 3 CYS A 28 ? ? 63.72 135.93 27 3 ARG A 30 ? ? 73.93 122.81 28 3 MET A 31 ? ? -165.18 -32.74 29 3 ALA A 32 ? ? 72.63 136.22 30 4 THR A 3 ? ? 158.97 -20.36 31 4 PHE A 10 ? ? 178.55 164.65 32 4 LYS A 11 ? ? -58.64 -149.72 33 4 ASP A 12 ? ? 174.88 -26.40 34 4 LYS A 13 ? ? 138.92 -51.04 35 4 CYS A 19 ? ? -34.24 129.20 36 4 LYS A 24 ? ? -150.45 15.60 37 4 THR A 29 ? ? -37.24 -89.66 38 4 ARG A 30 ? ? -172.81 -47.21 39 4 MET A 31 ? ? -16.35 -75.93 40 4 ALA A 32 ? ? -148.98 -149.58 41 5 THR A 8 ? ? -150.68 -30.40 42 5 THR A 9 ? ? 57.76 122.99 43 5 LYS A 13 ? ? 73.94 -76.84 44 5 CYS A 14 ? ? -134.77 -35.55 45 5 ASN A 15 ? ? -118.32 -169.20 46 5 CYS A 19 ? ? 69.48 106.29 47 5 THR A 29 ? ? -51.41 -103.54 48 5 ARG A 30 ? ? -179.36 34.43 49 5 MET A 31 ? ? -55.52 -82.41 50 5 ALA A 32 ? ? 158.92 121.76 51 6 CYS A 4 ? ? -43.77 169.11 52 6 LYS A 13 ? ? 64.49 -78.30 53 6 ARG A 18 ? ? -44.21 108.82 54 6 THR A 29 ? ? -55.16 -81.29 55 6 ARG A 30 ? ? -77.04 -138.60 56 6 MET A 31 ? ? 178.67 69.22 57 7 LYS A 13 ? ? 59.42 -81.04 58 7 CYS A 14 ? ? -157.55 18.60 59 7 LYS A 24 ? ? 48.33 23.34 60 7 MET A 31 ? ? 53.46 107.31 61 7 ALA A 32 ? ? 163.41 67.50 62 8 THR A 8 ? ? -153.26 -33.69 63 8 THR A 9 ? ? 75.68 144.51 64 8 ASP A 12 ? ? -130.15 -45.87 65 8 LYS A 13 ? ? -125.55 -98.05 66 8 CYS A 19 ? ? 62.49 91.31 67 8 LYS A 24 ? ? -150.53 51.02 68 8 CYS A 28 ? ? 74.85 138.62 69 8 ARG A 30 ? ? 70.54 82.47 70 8 ALA A 32 ? ? 67.52 135.20 71 9 LYS A 13 ? ? -120.59 -75.54 72 9 THR A 16 ? ? -58.49 174.11 73 9 CYS A 17 ? ? -164.86 106.10 74 9 CYS A 19 ? ? -35.59 107.97 75 9 LYS A 24 ? ? -142.29 38.07 76 9 SER A 25 ? ? -170.77 104.98 77 9 CYS A 28 ? ? 69.28 138.35 78 9 ARG A 30 ? ? -120.23 -71.09 79 9 MET A 31 ? ? 179.46 -71.03 80 9 ALA A 32 ? ? 164.85 124.49 81 10 THR A 8 ? ? -164.17 -18.11 82 10 THR A 9 ? ? 44.98 113.46 83 10 LYS A 13 ? ? 56.24 -107.67 84 10 ASN A 15 ? ? -155.06 -154.29 85 10 THR A 16 ? ? -117.36 -165.92 86 10 CYS A 17 ? ? 172.48 105.05 87 10 CYS A 19 ? ? 75.28 91.87 88 10 LYS A 24 ? ? -140.90 21.46 89 10 CYS A 28 ? ? 62.85 133.12 90 10 ARG A 30 ? ? 72.88 109.29 91 10 MET A 31 ? ? -136.80 -74.15 92 10 ALA A 32 ? ? 162.36 85.64 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 18 ? ? 0.313 'SIDE CHAIN' 2 1 ARG A 30 ? ? 0.250 'SIDE CHAIN' 3 2 ARG A 18 ? ? 0.242 'SIDE CHAIN' 4 2 ARG A 30 ? ? 0.292 'SIDE CHAIN' 5 3 ARG A 18 ? ? 0.195 'SIDE CHAIN' 6 3 ARG A 30 ? ? 0.284 'SIDE CHAIN' 7 4 ARG A 30 ? ? 0.317 'SIDE CHAIN' 8 5 ARG A 18 ? ? 0.214 'SIDE CHAIN' 9 5 ARG A 30 ? ? 0.245 'SIDE CHAIN' 10 6 ARG A 18 ? ? 0.314 'SIDE CHAIN' 11 6 ARG A 30 ? ? 0.222 'SIDE CHAIN' 12 7 ARG A 18 ? ? 0.180 'SIDE CHAIN' 13 7 ARG A 30 ? ? 0.316 'SIDE CHAIN' 14 8 ARG A 18 ? ? 0.197 'SIDE CHAIN' 15 8 ARG A 30 ? ? 0.233 'SIDE CHAIN' 16 9 ARG A 18 ? ? 0.118 'SIDE CHAIN' 17 9 ARG A 30 ? ? 0.203 'SIDE CHAIN' 18 10 ARG A 18 ? ? 0.285 'SIDE CHAIN' 19 10 ARG A 30 ? ? 0.215 'SIDE CHAIN' #