data_1KL8 # _entry.id 1KL8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KL8 pdb_00001kl8 10.2210/pdb1kl8/pdb RCSB RCSB015074 ? ? WWPDB D_1000015074 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1abt ;1ABT IS ALPHA-BUNGAROTOXIN COMPLEXED WITH THE 185 - 196 FRAGMENT OF THE -SUBUNIT OF THE TORPEDO NICOTINIC ACETYLCHOLINE RECEPTOR (NMR, 4 STRUCTURES). ; unspecified PDB 1idh ;1IDH IS THE NMR SOLUTION STRUCTURE OF THE COMPLEX FORMED BETWEEN ALPHA-BUNGAROTOXIN AND AN 18MER COGNATE PEPTIDE. ; unspecified PDB 2abx ;2ABX IS THE CRYSTAL STRUCTURE OF ALPHA-BUNGAROTOXIN AT 2.5 A RESOLUTION: RELATION TO SOLUTION STRUCTURE AND BINDING TO ACETYLCHOLINE RECEPTOR. ; unspecified PDB 1i9b ;1I9B IS THE X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP). ; unspecified PDB 1hc9 '1HC9 IS A-BUNGAROTOXIN COMPLEXED WITH HIGH AFFINITY PEPTIDE.' unspecified PDB 1jbd ;1JBD IS THE NMR STRUCTURE OF THE COMPLEX BETWEEN ALPHA- BUNGAROTOXIN AND A MIMOTOPE OF THE NICOTINIC ACETILCHOLINE RECEPTOR. ; unspecified PDB 1kc4 ;1kc4 is the NMR STRUCTURAL ANALYSIS OF THE COMPLEX FORMED BETWEEN ALPHA-BUNGAROTOXIN AND THE PRINCIPAL ALPHA-NEUROTOXIN BINDING SEQUENCE ON THE ALPHA7 SUBUNIT OF A NEURONAL NICOTINIC ACETYLCHOLINE RECEPTOR (ensemble of 10 structures). ; unspecified PDB 1KFH '1KFH IS the SOLUTION STRUCTURE OF ALPHA-BUNGAROTOXIN BY NMR SPECTROSCOPY.' unspecified PDB 1HAJ '1HAJ IS A BETA-HAIRPIN STRUCTURE IN A 13-MER PEPTIDE THAT BINDS A-BUNGAROTOXIN WITH HIGH AFFINITY AND NEUTRALIZES ITS TOXICITY.' unspecified PDB 1BXP '1BXP IS THE SOLUTION NMR STRUCTURE OF THE COMPLEX OF ALPHA-BUNGAROTOXIN WITH A LIBRARY DERIVED PEPTIDE, 20 STRUCTURES.' unspecified PDB 1IKC '1IKC IS THE NMR STRUCTURE OF ALPHA-BUNGAROTOXIN.' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KL8 _pdbx_database_status.recvd_initial_deposition_date 2001-12-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Moise, L.' 1 'Piserchio, A.' 2 'Basus, V.J.' 3 'Hawrot, E.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;NMR structural analysis of alpha-bungarotoxin and its complex with the principal alpha-neurotoxin-binding sequence on the alpha 7 subunit of a neuronal nicotinic acetylcholine receptor. ; J.Biol.Chem. 277 12406 12417 2002 JBCHA3 US 0021-9258 0071 ? 11790782 10.1074/jbc.M110320200 1 'Chimeric Analysis of a Neuronal Nicotinic Acetylcholine Receptor Reveals Amino Acids Conferring Sensitivity to Alpha-Bungarotoxin.' J.Biol.Chem. 274 26113 26119 1999 JBCHA3 US 0021-9258 0071 ? ? 10.1074/jbc.274.37.26113 2 ;Identification of Sequence Segments Forming the Alpha-Bungarotoxin Binding Sites on Two Nicotinic Acetylcholine Receptor Alpha Subunits from the Avian Brain. ; J.Biol.Chem. 266 15230 15239 1991 JBCHA3 US 0021-9258 0071 ? ? ? 3 'Structural Studies of Alpha-Bungarotoxin. 1. Sequence-Specific 1H NMR Resonance Assignments.' Biochemistry 27 2763 2771 1988 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moise, L.' 1 ? primary 'Piserchio, A.' 2 ? primary 'Basus, V.J.' 3 ? primary 'Hawrot, E.' 4 ? 1 'Levandoski, M.M.' 5 ? 1 'Lin, Y.' 6 ? 1 'Moise, L.' 7 ? 1 'Mclaughlin, J.T.' 8 ? 1 'Cooper, E.' 9 ? 1 'Hawrot, E.' 10 ? 2 'Mclane, K.E.' 11 ? 2 'Wu, X.D.' 12 ? 2 'Schoepfer, R.' 13 ? 2 'Lindstrom, J.M.' 14 ? 2 'Conti-Tronconi, B.M.' 15 ? 3 'Basus, V.J.' 16 ? 3 'Billeter, M.' 17 ? 3 'Love, R.A.' 18 ? 3 'Stroud, R.M.' 19 ? 3 'Kuntz, I.D.' 20 ? # _cell.entry_id 1KL8 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1KL8 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat ALPHA-BUNGAROTOXIN 8005.281 1 ? ? ? ? 2 polymer man 'NEURONAL ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA-7 CHAIN' 2348.629 1 ? ? 'ALPHA-NEUROTOXIN BINDING SITE' ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LONG NEUROTOXIN 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG A ? 2 'polypeptide(L)' no yes 'IPGKRTESFYECCKEPYPD(HSL)' IPGKRTESFYECCKEPYPDS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 CYS n 1 4 HIS n 1 5 THR n 1 6 THR n 1 7 ALA n 1 8 THR n 1 9 SER n 1 10 PRO n 1 11 ILE n 1 12 SER n 1 13 ALA n 1 14 VAL n 1 15 THR n 1 16 CYS n 1 17 PRO n 1 18 PRO n 1 19 GLY n 1 20 GLU n 1 21 ASN n 1 22 LEU n 1 23 CYS n 1 24 TYR n 1 25 ARG n 1 26 LYS n 1 27 MET n 1 28 TRP n 1 29 CYS n 1 30 ASP n 1 31 ALA n 1 32 PHE n 1 33 CYS n 1 34 SER n 1 35 SER n 1 36 ARG n 1 37 GLY n 1 38 LYS n 1 39 VAL n 1 40 VAL n 1 41 GLU n 1 42 LEU n 1 43 GLY n 1 44 CYS n 1 45 ALA n 1 46 ALA n 1 47 THR n 1 48 CYS n 1 49 PRO n 1 50 SER n 1 51 LYS n 1 52 LYS n 1 53 PRO n 1 54 TYR n 1 55 GLU n 1 56 GLU n 1 57 VAL n 1 58 THR n 1 59 CYS n 1 60 CYS n 1 61 SER n 1 62 THR n 1 63 ASP n 1 64 LYS n 1 65 CYS n 1 66 ASN n 1 67 PRO n 1 68 HIS n 1 69 PRO n 1 70 LYS n 1 71 GLN n 1 72 ARG n 1 73 PRO n 1 74 GLY n 2 1 ILE n 2 2 PRO n 2 3 GLY n 2 4 LYS n 2 5 ARG n 2 6 THR n 2 7 GLU n 2 8 SER n 2 9 PHE n 2 10 TYR n 2 11 GLU n 2 12 CYS n 2 13 CYS n 2 14 LYS n 2 15 GLU n 2 16 PRO n 2 17 TYR n 2 18 PRO n 2 19 ASP n 2 20 HSL n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BLR(DE3)PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET31B(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'many-banded krait' _entity_src_nat.pdbx_organism_scientific 'Bungarus multicinctus' _entity_src_nat.pdbx_ncbi_taxonomy_id 8616 _entity_src_nat.genus Bungarus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP NXL1A_BUNMU 1 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 1 P60615 ? 2 UNP ACHA7_CHICK 2 IPGKRTESFYECCKEPYPD 201 P22770 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1KL8 A 1 ? 74 ? P60615 1 ? 74 ? 1 74 2 2 1KL8 B 1 ? 19 ? P22770 201 ? 219 ? 178 196 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1KL8 _struct_ref_seq_dif.mon_id HSL _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 20 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P22770 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 197 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HSL 'L-peptide linking' n 'HOMOSERINE LACTONE' ? 'C4 H7 N O2' 101.104 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D TOCSY' 1 3 1 '3D_15 SEPARATED_NOESY' 1 4 1 '3D_15N- SEPARATED_TOCSY' 1 5 1 '2D 1H-15N HSQC' 1 6 1 HNHA 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308.00 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 5.50 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.6 MM ALPHA-BUNGAROTOXIN 15N]-ALPHA 7 19MER COMPLEX MM SODIUM PHOSPHATE, PH 5. MICROMOLAR SODIUM AZIDE 50 MICROMOLAR TMSP' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 AVANCE Bruker 400 ? # _pdbx_nmr_refine.entry_id 1KL8 _pdbx_nmr_refine.method 'DISTANCE GEOMETRY DYNAMIC SIMULATED ANNEALING' _pdbx_nmr_refine.details 'RMS DEVIATIONS FROM IDEAL VALUES BOND LENGTH(A) 0.0039, ANGLES(DEG) 0.61, IMPROPERS(DEG) 0.5' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1KL8 _pdbx_nmr_details.text ;THE WELL-DEFINED REGIONS IN THE COMPLEX, EXHIBITING EXTENSIVE LONG RANGE NOES, ARE: BGTX: 1-16, 22-28, 39-48, AND 54-68 ALPHA 7 19MER: 185-194. ; # _pdbx_nmr_ensemble.entry_id 1KL8 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1KL8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 1.0 'BRUNGER, A.T., ET AL.' 1 'structure solution' XwinNMR 2.1 ? 2 'structure solution' NMRPipe 1.8 ? 3 'structure solution' Sparky 3.87 ? 4 # _exptl.entry_id 1KL8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1KL8 _struct.title ;NMR STRUCTURAL ANALYSIS OF THE COMPLEX FORMED BETWEEN ALPHA-BUNGAROTOXIN AND THE PRINCIPAL ALPHA-NEUROTOXIN BINDING SEQUENCE ON THE ALPHA7 SUBUNIT OF A NEURONAL NICOTINIC ACETYLCHOLINE RECEPTOR ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1KL8 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text ;ALPHA-BUNGAROTOXIN, NICOTINIC ACETYLCHOLINE RECEPTOR ALPHA 7 SUBUNIT, ALPHA-NEUROTOXIN, LIGAND-GATED ION CHANNELS, NMR PROTEIN-PROTEIN INTERACTIONS, PROTEIN-PEPTIDE COMPLEX, TOXIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 3 A CYS 23 1_555 ? ? ? ? ? ? ? 1.992 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 16 A CYS 44 1_555 ? ? ? ? ? ? ? 1.996 ? ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 29 A CYS 33 1_555 ? ? ? ? ? ? ? 1.987 ? ? disulf4 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 48 A CYS 59 1_555 ? ? ? ? ? ? ? 1.994 ? ? disulf5 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 60 A CYS 65 1_555 ? ? ? ? ? ? ? 1.978 ? ? disulf6 disulf ? ? B CYS 12 SG ? ? ? 1_555 B CYS 13 SG ? ? B CYS 189 B CYS 190 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 41 ? ALA A 45 ? GLU A 41 ALA A 45 A 2 LEU A 22 ? LYS A 26 ? LEU A 22 LYS A 26 A 3 VAL A 57 ? THR A 58 ? VAL A 57 THR A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 45 ? O ALA A 45 N LEU A 22 ? N LEU A 22 A 2 3 N ARG A 25 ? N ARG A 25 O THR A 58 ? O THR A 58 # _database_PDB_matrix.entry_id 1KL8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KL8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLY 74 74 74 GLY GLY A . n B 2 1 ILE 1 178 178 ILE ILE B . n B 2 2 PRO 2 179 179 PRO PRO B . n B 2 3 GLY 3 180 180 GLY GLY B . n B 2 4 LYS 4 181 181 LYS LYS B . n B 2 5 ARG 5 182 182 ARG ARG B . n B 2 6 THR 6 183 183 THR THR B . n B 2 7 GLU 7 184 184 GLU GLU B . n B 2 8 SER 8 185 185 SER SER B . n B 2 9 PHE 9 186 186 PHE PHE B . n B 2 10 TYR 10 187 187 TYR TYR B . n B 2 11 GLU 11 188 188 GLU GLU B . n B 2 12 CYS 12 189 189 CYS CYS B . n B 2 13 CYS 13 190 190 CYS CYS B . n B 2 14 LYS 14 191 191 LYS LYS B . n B 2 15 GLU 15 192 192 GLU GLU B . n B 2 16 PRO 16 193 193 PRO PRO B . n B 2 17 TYR 17 194 194 TYR TYR B . n B 2 18 PRO 18 195 195 PRO PRO B . n B 2 19 ASP 19 196 196 ASP ASP B . n B 2 20 HSL 20 197 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-03-13 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH1 A ARG 25 ? ? 123.61 120.30 3.31 0.50 N 2 1 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 123.50 120.30 3.20 0.50 N 3 1 NE B ARG 182 ? ? CZ B ARG 182 ? ? NH1 B ARG 182 ? ? 123.46 120.30 3.16 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 5 ? ? -51.52 170.42 2 1 ALA A 7 ? ? 74.74 52.78 3 1 SER A 9 ? ? -167.13 -65.38 4 1 SER A 12 ? ? -115.36 -147.86 5 1 ASN A 21 ? ? -154.64 -51.02 6 1 CYS A 29 ? ? -139.82 -51.85 7 1 ALA A 31 ? ? 174.53 -91.86 8 1 PHE A 32 ? ? 177.94 90.30 9 1 SER A 34 ? ? 66.79 153.08 10 1 SER A 35 ? ? 78.70 -79.53 11 1 VAL A 40 ? ? 40.17 94.47 12 1 SER A 50 ? ? -173.77 123.24 13 1 LYS A 51 ? ? -178.03 61.49 14 1 LYS A 52 ? ? 55.86 70.84 15 1 GLU A 55 ? ? 115.79 91.85 16 1 GLU A 56 ? ? -159.82 -151.62 17 1 THR A 62 ? ? -166.63 -165.35 18 1 ASP A 63 ? ? -76.08 -132.94 19 1 LYS A 64 ? ? -58.25 73.84 20 1 PRO A 67 ? ? -51.17 97.78 21 1 PRO A 69 ? ? -50.68 -72.77 22 1 PRO A 73 ? ? -67.41 -174.51 23 1 LYS B 181 ? ? 67.84 124.49 24 1 THR B 183 ? ? -101.72 59.59 25 1 SER B 185 ? ? -101.52 -167.21 26 1 TYR B 187 ? ? -124.09 -152.43 27 1 CYS B 189 ? ? -170.48 -42.84 28 1 CYS B 190 ? ? -162.11 41.80 29 1 GLU B 192 ? ? 70.81 -148.93 30 1 TYR B 194 ? ? -2.66 -68.71 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id B _pdbx_validate_planes.auth_seq_id 194 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.110 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id B _pdbx_unobs_or_zero_occ_residues.auth_comp_id HSL _pdbx_unobs_or_zero_occ_residues.auth_seq_id 197 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id B _pdbx_unobs_or_zero_occ_residues.label_comp_id HSL _pdbx_unobs_or_zero_occ_residues.label_seq_id 20 #