data_1KLC # _entry.id 1KLC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1KLC WWPDB D_1000174452 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1KLA . ensemble PDB 1KLD . ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KLC _pdbx_database_status.recvd_initial_deposition_date 1996-01-16 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hinck, A.P.' 1 'Archer, S.J.' 2 'Qian, S.W.' 3 'Roberts, A.B.' 4 'Sporn, M.B.' 5 'Weatherbee, J.A.' 6 'Tsang, M.L.-S.' 7 'Lucas, R.' 8 'Zhang, B.-L.' 9 'Wenker, J.' 10 'Torchia, D.A.' 11 # _citation.id primary _citation.title ;Transforming growth factor beta 1: three-dimensional structure in solution and comparison with the X-ray structure of transforming growth factor beta 2. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 35 _citation.page_first 8517 _citation.page_last 8534 _citation.year 1996 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8679613 _citation.pdbx_database_id_DOI 10.1021/bi9604946 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hinck, A.P.' 1 primary 'Archer, S.J.' 2 primary 'Qian, S.W.' 3 primary 'Roberts, A.B.' 4 primary 'Sporn, M.B.' 5 primary 'Weatherbee, J.A.' 6 primary 'Tsang, M.L.' 7 primary 'Lucas, R.' 8 primary 'Zhang, B.L.' 9 primary 'Wenker, J.' 10 primary 'Torchia, D.A.' 11 # _cell.entry_id 1KLC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1KLC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TRANSFORMING GROWTH FACTOR-BETA 1' _entity.formula_weight 12809.812 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details '1 MM (IN DIMER), PH 4.2' # _entity_name_com.entity_id 1 _entity_name_com.name TGF-B1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS ; _entity_poly.pdbx_seq_one_letter_code_can ;ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 ASP n 1 4 THR n 1 5 ASN n 1 6 TYR n 1 7 CYS n 1 8 PHE n 1 9 SER n 1 10 SER n 1 11 THR n 1 12 GLU n 1 13 LYS n 1 14 ASN n 1 15 CYS n 1 16 CYS n 1 17 VAL n 1 18 ARG n 1 19 GLN n 1 20 LEU n 1 21 TYR n 1 22 ILE n 1 23 ASP n 1 24 PHE n 1 25 ARG n 1 26 LYS n 1 27 ASP n 1 28 LEU n 1 29 GLY n 1 30 TRP n 1 31 LYS n 1 32 TRP n 1 33 ILE n 1 34 HIS n 1 35 GLU n 1 36 PRO n 1 37 LYS n 1 38 GLY n 1 39 TYR n 1 40 HIS n 1 41 ALA n 1 42 ASN n 1 43 PHE n 1 44 CYS n 1 45 LEU n 1 46 GLY n 1 47 PRO n 1 48 CYS n 1 49 PRO n 1 50 TYR n 1 51 ILE n 1 52 TRP n 1 53 SER n 1 54 LEU n 1 55 ASP n 1 56 THR n 1 57 GLN n 1 58 TYR n 1 59 SER n 1 60 LYS n 1 61 VAL n 1 62 LEU n 1 63 ALA n 1 64 LEU n 1 65 TYR n 1 66 ASN n 1 67 GLN n 1 68 HIS n 1 69 ASN n 1 70 PRO n 1 71 GLY n 1 72 ALA n 1 73 SER n 1 74 ALA n 1 75 ALA n 1 76 PRO n 1 77 CYS n 1 78 CYS n 1 79 VAL n 1 80 PRO n 1 81 GLN n 1 82 ALA n 1 83 LEU n 1 84 GLU n 1 85 PRO n 1 86 LEU n 1 87 PRO n 1 88 ILE n 1 89 VAL n 1 90 TYR n 1 91 TYR n 1 92 VAL n 1 93 GLY n 1 94 ARG n 1 95 LYS n 1 96 PRO n 1 97 LYS n 1 98 VAL n 1 99 GLU n 1 100 GLN n 1 101 LEU n 1 102 SER n 1 103 ASN n 1 104 MET n 1 105 ILE n 1 106 VAL n 1 107 ARG n 1 108 SER n 1 109 CYS n 1 110 LYS n 1 111 CYS n 1 112 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ OVARY _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Chinese hamster' _entity_src_gen.pdbx_host_org_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10029 _entity_src_gen.host_org_genus Cricetulus _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TGFB1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01137 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLAL YNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRL KLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHAN FCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1KLC A 1 ? 112 ? P01137 279 ? 390 ? 1 112 2 1 1KLC B 1 ? 112 ? P01137 279 ? 390 ? 1 112 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_details.entry_id 1KLC _pdbx_nmr_details.text 'THIS ENTRY CONTAINS MINIMIZED AVERAGE STRUCTURE. 1 MM (IN DIMER).' # _pdbx_nmr_ensemble.entry_id 1KLC _pdbx_nmr_ensemble.conformers_calculated_total_number 33 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' XPLOR 3.1 ? 2 # _exptl.entry_id 1KLC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1KLC _struct.title 'SOLUTION STRUCTURE OF TGF-B1, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_descriptor 'TRANSFORMING GROWTH FACTOR-BETA 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KLC _struct_keywords.pdbx_keywords 'GROWTH FACTOR' _struct_keywords.text 'GROWTH FACTOR, MITOGEN, GLYCOPROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 57 ? HIS A 68 ? GLN A 57 HIS A 68 1 ? 12 HELX_P HELX_P2 2 GLN B 57 ? HIS B 68 ? GLN B 57 HIS B 68 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 7 A CYS 16 1_555 ? ? ? ? ? ? ? 2.021 ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 78 SG ? ? A CYS 15 A CYS 78 1_555 ? ? ? ? ? ? ? 2.025 ? disulf3 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 109 SG ? ? A CYS 44 A CYS 109 1_555 ? ? ? ? ? ? ? 2.018 ? disulf4 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 48 A CYS 111 1_555 ? ? ? ? ? ? ? 2.021 ? disulf5 disulf ? ? A CYS 77 SG ? ? ? 1_555 B CYS 77 SG ? ? A CYS 77 B CYS 77 1_555 ? ? ? ? ? ? ? 2.018 ? disulf6 disulf ? ? B CYS 7 SG ? ? ? 1_555 B CYS 16 SG ? ? B CYS 7 B CYS 16 1_555 ? ? ? ? ? ? ? 2.021 ? disulf7 disulf ? ? B CYS 15 SG ? ? ? 1_555 B CYS 78 SG ? ? B CYS 15 B CYS 78 1_555 ? ? ? ? ? ? ? 2.025 ? disulf8 disulf ? ? B CYS 44 SG ? ? ? 1_555 B CYS 109 SG ? ? B CYS 44 B CYS 109 1_555 ? ? ? ? ? ? ? 2.017 ? disulf9 disulf ? ? B CYS 48 SG ? ? ? 1_555 B CYS 111 SG ? ? B CYS 48 B CYS 111 1_555 ? ? ? ? ? ? ? 2.023 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 35 A . ? GLU 35 A PRO 36 A ? PRO 36 A 1 0.06 2 GLU 35 B . ? GLU 35 B PRO 36 B ? PRO 36 B 1 -0.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? D ? 2 ? E ? 2 ? F ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? anti-parallel F 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 16 ? ARG A 18 ? CYS A 16 ARG A 18 A 2 PHE A 43 ? LEU A 45 ? PHE A 43 LEU A 45 B 1 TYR A 90 ? VAL A 92 ? TYR A 90 VAL A 92 B 2 LYS A 95 ? LYS A 97 ? LYS A 95 LYS A 97 C 1 CYS B 16 ? ARG B 18 ? CYS B 16 ARG B 18 C 2 PHE B 43 ? LEU B 45 ? PHE B 43 LEU B 45 D 1 TYR B 90 ? VAL B 92 ? TYR B 90 VAL B 92 D 2 LYS B 95 ? LYS B 97 ? LYS B 95 LYS B 97 E 1 CYS A 77 ? ALA A 82 ? CYS A 77 ALA A 82 E 2 SER A 108 ? SER A 112 ? SER A 108 SER A 112 F 1 CYS B 77 ? ALA B 82 ? CYS B 77 ALA B 82 F 2 SER B 108 ? SER B 112 ? SER B 108 SER B 112 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 16 ? O CYS A 16 N LEU A 45 ? N LEU A 45 B 1 2 O TYR A 90 ? O TYR A 90 N LYS A 97 ? N LYS A 97 C 1 2 O CYS B 16 ? O CYS B 16 N LEU B 45 ? N LEU B 45 D 1 2 O TYR B 90 ? O TYR B 90 N LYS B 97 ? N LYS B 97 E 1 2 O CYS A 77 ? O CYS A 77 N SER A 112 ? N SER A 112 F 1 2 O CYS B 77 ? O CYS B 77 N SER B 112 ? N SER B 112 # _database_PDB_matrix.entry_id 1KLC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KLC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 CYS 111 111 111 CYS CYS A . n A 1 112 SER 112 112 112 SER SER A . n B 1 1 ALA 1 1 1 ALA ALA B . n B 1 2 LEU 2 2 2 LEU LEU B . n B 1 3 ASP 3 3 3 ASP ASP B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 ASN 5 5 5 ASN ASN B . n B 1 6 TYR 6 6 6 TYR TYR B . n B 1 7 CYS 7 7 7 CYS CYS B . n B 1 8 PHE 8 8 8 PHE PHE B . n B 1 9 SER 9 9 9 SER SER B . n B 1 10 SER 10 10 10 SER SER B . n B 1 11 THR 11 11 11 THR THR B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 LYS 13 13 13 LYS LYS B . n B 1 14 ASN 14 14 14 ASN ASN B . n B 1 15 CYS 15 15 15 CYS CYS B . n B 1 16 CYS 16 16 16 CYS CYS B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 ARG 18 18 18 ARG ARG B . n B 1 19 GLN 19 19 19 GLN GLN B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 TYR 21 21 21 TYR TYR B . n B 1 22 ILE 22 22 22 ILE ILE B . n B 1 23 ASP 23 23 23 ASP ASP B . n B 1 24 PHE 24 24 24 PHE PHE B . n B 1 25 ARG 25 25 25 ARG ARG B . n B 1 26 LYS 26 26 26 LYS LYS B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 GLY 29 29 29 GLY GLY B . n B 1 30 TRP 30 30 30 TRP TRP B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 TRP 32 32 32 TRP TRP B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 HIS 34 34 34 HIS HIS B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 PRO 36 36 36 PRO PRO B . n B 1 37 LYS 37 37 37 LYS LYS B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 TYR 39 39 39 TYR TYR B . n B 1 40 HIS 40 40 40 HIS HIS B . n B 1 41 ALA 41 41 41 ALA ALA B . n B 1 42 ASN 42 42 42 ASN ASN B . n B 1 43 PHE 43 43 43 PHE PHE B . n B 1 44 CYS 44 44 44 CYS CYS B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 GLY 46 46 46 GLY GLY B . n B 1 47 PRO 47 47 47 PRO PRO B . n B 1 48 CYS 48 48 48 CYS CYS B . n B 1 49 PRO 49 49 49 PRO PRO B . n B 1 50 TYR 50 50 50 TYR TYR B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 TRP 52 52 52 TRP TRP B . n B 1 53 SER 53 53 53 SER SER B . n B 1 54 LEU 54 54 54 LEU LEU B . n B 1 55 ASP 55 55 55 ASP ASP B . n B 1 56 THR 56 56 56 THR THR B . n B 1 57 GLN 57 57 57 GLN GLN B . n B 1 58 TYR 58 58 58 TYR TYR B . n B 1 59 SER 59 59 59 SER SER B . n B 1 60 LYS 60 60 60 LYS LYS B . n B 1 61 VAL 61 61 61 VAL VAL B . n B 1 62 LEU 62 62 62 LEU LEU B . n B 1 63 ALA 63 63 63 ALA ALA B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 TYR 65 65 65 TYR TYR B . n B 1 66 ASN 66 66 66 ASN ASN B . n B 1 67 GLN 67 67 67 GLN GLN B . n B 1 68 HIS 68 68 68 HIS HIS B . n B 1 69 ASN 69 69 69 ASN ASN B . n B 1 70 PRO 70 70 70 PRO PRO B . n B 1 71 GLY 71 71 71 GLY GLY B . n B 1 72 ALA 72 72 72 ALA ALA B . n B 1 73 SER 73 73 73 SER SER B . n B 1 74 ALA 74 74 74 ALA ALA B . n B 1 75 ALA 75 75 75 ALA ALA B . n B 1 76 PRO 76 76 76 PRO PRO B . n B 1 77 CYS 77 77 77 CYS CYS B . n B 1 78 CYS 78 78 78 CYS CYS B . n B 1 79 VAL 79 79 79 VAL VAL B . n B 1 80 PRO 80 80 80 PRO PRO B . n B 1 81 GLN 81 81 81 GLN GLN B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 GLU 84 84 84 GLU GLU B . n B 1 85 PRO 85 85 85 PRO PRO B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 PRO 87 87 87 PRO PRO B . n B 1 88 ILE 88 88 88 ILE ILE B . n B 1 89 VAL 89 89 89 VAL VAL B . n B 1 90 TYR 90 90 90 TYR TYR B . n B 1 91 TYR 91 91 91 TYR TYR B . n B 1 92 VAL 92 92 92 VAL VAL B . n B 1 93 GLY 93 93 93 GLY GLY B . n B 1 94 ARG 94 94 94 ARG ARG B . n B 1 95 LYS 95 95 95 LYS LYS B . n B 1 96 PRO 96 96 96 PRO PRO B . n B 1 97 LYS 97 97 97 LYS LYS B . n B 1 98 VAL 98 98 98 VAL VAL B . n B 1 99 GLU 99 99 99 GLU GLU B . n B 1 100 GLN 100 100 100 GLN GLN B . n B 1 101 LEU 101 101 101 LEU LEU B . n B 1 102 SER 102 102 102 SER SER B . n B 1 103 ASN 103 103 103 ASN ASN B . n B 1 104 MET 104 104 104 MET MET B . n B 1 105 ILE 105 105 105 ILE ILE B . n B 1 106 VAL 106 106 106 VAL VAL B . n B 1 107 ARG 107 107 107 ARG ARG B . n B 1 108 SER 108 108 108 SER SER B . n B 1 109 CYS 109 109 109 CYS CYS B . n B 1 110 LYS 110 110 110 LYS LYS B . n B 1 111 CYS 111 111 111 CYS CYS B . n B 1 112 SER 112 112 112 SER SER B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-08-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? -102.14 66.57 2 1 PHE A 8 ? ? -90.00 30.51 3 1 SER A 9 ? ? -123.49 -91.07 4 1 SER A 10 ? ? -83.21 -158.62 5 1 LYS A 13 ? ? -135.02 -37.78 6 1 ASN A 14 ? ? -60.35 -146.18 7 1 LEU A 20 ? ? -142.72 46.66 8 1 PHE A 24 ? ? -13.92 -55.82 9 1 TYR A 39 ? ? 179.14 177.64 10 1 ASN A 42 ? ? 52.33 176.05 11 1 PHE A 43 ? ? 178.63 -170.26 12 1 PRO A 47 ? ? -78.36 -160.88 13 1 PRO A 49 ? ? -72.84 -154.70 14 1 SER A 53 ? ? 42.85 75.61 15 1 ALA A 75 ? ? -52.64 -175.12 16 1 PRO A 76 ? ? -77.77 -161.56 17 1 LEU A 83 ? ? -124.62 -169.44 18 1 PRO A 85 ? ? -74.97 -162.35 19 1 LEU A 86 ? ? -165.19 109.81 20 1 ILE A 88 ? ? -119.64 -160.88 21 1 VAL A 89 ? ? -164.28 110.52 22 1 ARG A 94 ? ? -140.61 -3.38 23 1 GLU A 99 ? ? -132.66 -159.14 24 1 ARG A 107 ? ? -144.22 13.26 25 1 SER A 108 ? ? 163.11 125.14 26 1 LYS A 110 ? ? -168.25 -141.61 27 1 LEU B 2 ? ? -101.63 67.16 28 1 ASP B 3 ? ? -120.80 -169.83 29 1 PHE B 8 ? ? -90.00 30.42 30 1 SER B 9 ? ? -123.47 -91.06 31 1 SER B 10 ? ? -83.21 -158.66 32 1 LYS B 13 ? ? -134.98 -37.76 33 1 ASN B 14 ? ? -60.33 -146.23 34 1 LEU B 20 ? ? -142.71 46.71 35 1 PHE B 24 ? ? -13.98 -55.76 36 1 TYR B 39 ? ? 179.12 177.66 37 1 ASN B 42 ? ? 52.38 175.97 38 1 PHE B 43 ? ? 178.20 -171.31 39 1 PRO B 47 ? ? -78.50 -160.97 40 1 PRO B 49 ? ? -72.85 -154.70 41 1 SER B 53 ? ? 42.74 75.62 42 1 ALA B 75 ? ? -52.66 -175.20 43 1 PRO B 76 ? ? -77.79 -161.44 44 1 LEU B 83 ? ? -124.45 -169.27 45 1 PRO B 85 ? ? -74.98 -162.38 46 1 LEU B 86 ? ? -165.18 109.81 47 1 ILE B 88 ? ? -119.72 -160.80 48 1 VAL B 89 ? ? -164.28 110.48 49 1 ARG B 94 ? ? -140.59 -3.40 50 1 GLU B 99 ? ? -132.63 -159.17 51 1 ARG B 107 ? ? -144.57 14.68 52 1 SER B 108 ? ? 163.64 128.34 53 1 LYS B 110 ? ? -168.52 -148.18 54 1 CYS B 111 ? ? -155.48 83.02 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 18 ? ? 0.233 'SIDE CHAIN' 2 1 ARG A 25 ? ? 0.105 'SIDE CHAIN' 3 1 ARG A 94 ? ? 0.244 'SIDE CHAIN' 4 1 ARG A 107 ? ? 0.300 'SIDE CHAIN' 5 1 ARG B 18 ? ? 0.233 'SIDE CHAIN' 6 1 ARG B 25 ? ? 0.103 'SIDE CHAIN' 7 1 ARG B 94 ? ? 0.244 'SIDE CHAIN' 8 1 ARG B 107 ? ? 0.300 'SIDE CHAIN' #