data_1KQV # _entry.id 1KQV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KQV pdb_00001kqv 10.2210/pdb1kqv/pdb RCSB RCSB015246 ? ? WWPDB D_1000015246 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-01-16 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KQV _pdbx_database_status.recvd_initial_deposition_date 2002-01-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1k31 _pdbx_database_related.details '1k31 is the Average NMR Solution Structure Of Ca Ln Calbindin D9K' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bertini, I.' 1 'Donaire, A.' 2 'Jimenez, B.' 3 'Luchinat, C.' 4 'Parigi, G.' 5 'Piccioli, M.' 6 'Poggi, L.' 7 # _citation.id primary _citation.title 'Paramagnetism-based versus classical constraints: an analysis of the solution structure of Ca Ln calbindin D9k.' _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 21 _citation.page_first 85 _citation.page_last 98 _citation.year 2001 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11727989 _citation.pdbx_database_id_DOI 10.1023/A:1012422402545 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bertini, I.' 1 ? primary 'Donaire, A.' 2 ? primary 'Jimenez, B.' 3 ? primary 'Luchinat, C.' 4 ? primary 'Parigi, G.' 5 ? primary 'Piccioli, M.' 6 ? primary 'Poggi, L.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN' 8963.168 1 ? P43M ? ? 2 non-polymer syn 'LANTHANUM (III) ION' 138.905 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CABP, CALBINDIN D9K' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSAKKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _entity_poly.pdbx_seq_one_letter_code_can MSAKKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'LANTHANUM (III) ION' _pdbx_entity_nonpoly.comp_id LA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ALA n 1 4 LYS n 1 5 LYS n 1 6 SER n 1 7 PRO n 1 8 GLU n 1 9 GLU n 1 10 LEU n 1 11 LYS n 1 12 GLY n 1 13 ILE n 1 14 PHE n 1 15 GLU n 1 16 LYS n 1 17 TYR n 1 18 ALA n 1 19 ALA n 1 20 LYS n 1 21 GLU n 1 22 GLY n 1 23 ASP n 1 24 PRO n 1 25 ASN n 1 26 GLN n 1 27 LEU n 1 28 SER n 1 29 LYS n 1 30 GLU n 1 31 GLU n 1 32 LEU n 1 33 LYS n 1 34 LEU n 1 35 LEU n 1 36 LEU n 1 37 GLN n 1 38 THR n 1 39 GLU n 1 40 PHE n 1 41 PRO n 1 42 SER n 1 43 LEU n 1 44 LEU n 1 45 LYS n 1 46 GLY n 1 47 MET n 1 48 SER n 1 49 THR n 1 50 LEU n 1 51 ASP n 1 52 GLU n 1 53 LEU n 1 54 PHE n 1 55 GLU n 1 56 GLU n 1 57 LEU n 1 58 ASP n 1 59 LYS n 1 60 ASN n 1 61 GLY n 1 62 ASP n 1 63 GLY n 1 64 GLU n 1 65 VAL n 1 66 SER n 1 67 PHE n 1 68 GLU n 1 69 GLU n 1 70 PHE n 1 71 GLN n 1 72 VAL n 1 73 LEU n 1 74 VAL n 1 75 LYS n 1 76 LYS n 1 77 ILE n 1 78 SER n 1 79 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LA non-polymer . 'LANTHANUM (III) ION' ? 'La 3' 138.905 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 ALA 3 -1 ? ? ? A . n A 1 4 LYS 4 0 ? ? ? A . n A 1 5 LYS 5 1 1 LYS LYS A . n A 1 6 SER 6 2 2 SER SER A . n A 1 7 PRO 7 3 3 PRO PRO A . n A 1 8 GLU 8 4 4 GLU GLU A . n A 1 9 GLU 9 5 5 GLU GLU A . n A 1 10 LEU 10 6 6 LEU LEU A . n A 1 11 LYS 11 7 7 LYS LYS A . n A 1 12 GLY 12 8 8 GLY GLY A . n A 1 13 ILE 13 9 9 ILE ILE A . n A 1 14 PHE 14 10 10 PHE PHE A . n A 1 15 GLU 15 11 11 GLU GLU A . n A 1 16 LYS 16 12 12 LYS LYS A . n A 1 17 TYR 17 13 13 TYR TYR A . n A 1 18 ALA 18 14 14 ALA ALA A . n A 1 19 ALA 19 15 15 ALA ALA A . n A 1 20 LYS 20 16 16 LYS LYS A . n A 1 21 GLU 21 17 17 GLU GLU A . n A 1 22 GLY 22 18 18 GLY GLY A . n A 1 23 ASP 23 19 19 ASP ASP A . n A 1 24 PRO 24 20 20 PRO PRO A . n A 1 25 ASN 25 21 21 ASN ASN A . n A 1 26 GLN 26 22 22 GLN GLN A . n A 1 27 LEU 27 23 23 LEU LEU A . n A 1 28 SER 28 24 24 SER SER A . n A 1 29 LYS 29 25 25 LYS LYS A . n A 1 30 GLU 30 26 26 GLU GLU A . n A 1 31 GLU 31 27 27 GLU GLU A . n A 1 32 LEU 32 28 28 LEU LEU A . n A 1 33 LYS 33 29 29 LYS LYS A . n A 1 34 LEU 34 30 30 LEU LEU A . n A 1 35 LEU 35 31 31 LEU LEU A . n A 1 36 LEU 36 32 32 LEU LEU A . n A 1 37 GLN 37 33 33 GLN GLN A . n A 1 38 THR 38 34 34 THR THR A . n A 1 39 GLU 39 35 35 GLU GLU A . n A 1 40 PHE 40 36 36 PHE PHE A . n A 1 41 PRO 41 37 37 PRO PRO A . n A 1 42 SER 42 38 38 SER SER A . n A 1 43 LEU 43 39 39 LEU LEU A . n A 1 44 LEU 44 40 40 LEU LEU A . n A 1 45 LYS 45 41 41 LYS LYS A . n A 1 46 GLY 46 42 42 GLY GLY A . n A 1 47 MET 47 43 43 MET MET A . n A 1 48 SER 48 44 44 SER SER A . n A 1 49 THR 49 45 45 THR THR A . n A 1 50 LEU 50 46 46 LEU LEU A . n A 1 51 ASP 51 47 47 ASP ASP A . n A 1 52 GLU 52 48 48 GLU GLU A . n A 1 53 LEU 53 49 49 LEU LEU A . n A 1 54 PHE 54 50 50 PHE PHE A . n A 1 55 GLU 55 51 51 GLU GLU A . n A 1 56 GLU 56 52 52 GLU GLU A . n A 1 57 LEU 57 53 53 LEU LEU A . n A 1 58 ASP 58 54 54 ASP ASP A . n A 1 59 LYS 59 55 55 LYS LYS A . n A 1 60 ASN 60 56 56 ASN ASN A . n A 1 61 GLY 61 57 57 GLY GLY A . n A 1 62 ASP 62 58 58 ASP ASP A . n A 1 63 GLY 63 59 59 GLY GLY A . n A 1 64 GLU 64 60 60 GLU GLU A . n A 1 65 VAL 65 61 61 VAL VAL A . n A 1 66 SER 66 62 62 SER SER A . n A 1 67 PHE 67 63 63 PHE PHE A . n A 1 68 GLU 68 64 64 GLU GLU A . n A 1 69 GLU 69 65 65 GLU GLU A . n A 1 70 PHE 70 66 66 PHE PHE A . n A 1 71 GLN 71 67 67 GLN GLN A . n A 1 72 VAL 72 68 68 VAL VAL A . n A 1 73 LEU 73 69 69 LEU LEU A . n A 1 74 VAL 74 70 70 VAL VAL A . n A 1 75 LYS 75 71 71 LYS LYS A . n A 1 76 LYS 76 72 72 LYS LYS A . n A 1 77 ILE 77 73 73 ILE ILE A . n A 1 78 SER 78 74 74 SER SER A . n A 1 79 GLN 79 75 75 GLN GLN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id LA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 105 _pdbx_nonpoly_scheme.auth_seq_num 105 _pdbx_nonpoly_scheme.pdb_mon_id LA _pdbx_nonpoly_scheme.auth_mon_id LA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1KQV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1KQV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1KQV _struct.title 'Family of NMR Solution Structures of Ca Ln Calbindin D9K' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KQV _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'calcium binding proteins, NMR solution structure, paramagnetism-based constraints, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100G_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSAKKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _struct_ref.pdbx_align_begin 0 _struct_ref.pdbx_db_accession P02633 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KQV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02633 _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -3 _struct_ref_seq.pdbx_auth_seq_align_end 75 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1KQV _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 47 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02633 _struct_ref_seq_dif.db_mon_id PRO _struct_ref_seq_dif.pdbx_seq_db_seq_num 46 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 43 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? ALA A 19 ? SER A 2 ALA A 15 1 ? 14 HELX_P HELX_P2 2 SER A 28 ? GLU A 39 ? SER A 24 GLU A 35 1 ? 12 HELX_P HELX_P3 3 PRO A 41 ? GLY A 46 ? PRO A 37 GLY A 42 1 ? 6 HELX_P HELX_P4 4 THR A 49 ? ASP A 58 ? THR A 45 ASP A 54 1 ? 10 HELX_P HELX_P5 5 SER A 66 ? ILE A 77 ? SER A 62 ILE A 73 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id LA _struct_site.pdbx_auth_seq_id 105 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE LA A 105' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 58 ? ASP A 54 . ? 1_555 ? 2 AC1 5 ASN A 60 ? ASN A 56 . ? 1_555 ? 3 AC1 5 ASP A 62 ? ASP A 58 . ? 1_555 ? 4 AC1 5 GLU A 64 ? GLU A 60 . ? 1_555 ? 5 AC1 5 GLU A 69 ? GLU A 65 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 46 ? ? H A PHE 50 ? ? 1.53 2 1 O A SER 24 ? ? H A LEU 28 ? ? 1.56 3 1 O A GLU 48 ? ? H A GLU 52 ? ? 1.59 4 1 O A LEU 28 ? ? H A LEU 32 ? ? 1.59 5 1 OD2 A ASP 58 ? ? LA A LA 105 ? ? 2.09 6 2 OD2 A ASP 58 ? ? LA A LA 105 ? ? 1.32 7 2 H A LEU 23 ? ? O A VAL 61 ? ? 1.46 8 2 O A SER 24 ? ? H A LEU 28 ? ? 1.53 9 2 O A LEU 49 ? ? H A LEU 53 ? ? 1.60 10 2 CG A ASP 58 ? ? LA A LA 105 ? ? 1.86 11 2 OD1 A ASP 58 ? ? LA A LA 105 ? ? 2.07 12 3 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.70 13 3 ND2 A ASN 56 ? ? LA A LA 105 ? ? 0.98 14 3 H A LEU 23 ? ? O A VAL 61 ? ? 1.47 15 3 O A LEU 46 ? ? H A PHE 50 ? ? 1.56 16 3 O A GLU 48 ? ? H A GLU 52 ? ? 1.57 17 3 O A SER 24 ? ? H A LEU 28 ? ? 1.57 18 3 O A LEU 49 ? ? H A LEU 53 ? ? 1.60 19 3 CG A ASN 56 ? ? LA A LA 105 ? ? 1.66 20 3 OD1 A ASN 56 ? ? LA A LA 105 ? ? 2.08 21 4 O A LEU 46 ? ? H A PHE 50 ? ? 1.54 22 4 H A LYS 55 ? ? OE2 A GLU 65 ? ? 1.55 23 4 O A SER 24 ? ? H A LEU 28 ? ? 1.59 24 5 HD22 A ASN 56 ? ? LA A LA 105 ? ? 1.49 25 5 OD1 A ASP 58 ? ? H A GLY 59 ? ? 1.55 26 5 O A SER 24 ? ? H A LEU 28 ? ? 1.56 27 5 O A LEU 46 ? ? H A PHE 50 ? ? 1.57 28 5 O A LEU 49 ? ? H A LEU 53 ? ? 1.60 29 5 ND2 A ASN 56 ? ? LA A LA 105 ? ? 1.80 30 5 OD1 A ASN 56 ? ? LA A LA 105 ? ? 1.82 31 5 CG A ASN 56 ? ? LA A LA 105 ? ? 1.92 32 6 HD22 A ASN 56 ? ? LA A LA 105 ? ? 1.10 33 6 O A LEU 46 ? ? H A PHE 50 ? ? 1.51 34 6 O A SER 24 ? ? H A LEU 28 ? ? 1.56 35 6 ND2 A ASN 56 ? ? LA A LA 105 ? ? 1.88 36 7 O A LEU 46 ? ? H A PHE 50 ? ? 1.53 37 7 O A SER 24 ? ? H A LEU 28 ? ? 1.58 38 7 O A GLU 48 ? ? H A GLU 52 ? ? 1.58 39 7 O A LEU 49 ? ? H A LEU 53 ? ? 1.59 40 7 OD1 A ASP 58 ? ? LA A LA 105 ? ? 2.19 41 8 O A GLY 8 ? ? H A LYS 12 ? ? 1.58 42 8 O A SER 24 ? ? H A LEU 28 ? ? 1.58 43 9 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.49 44 9 ND2 A ASN 56 ? ? LA A LA 105 ? ? 0.71 45 9 O A SER 24 ? ? H A LEU 28 ? ? 1.53 46 9 HD21 A ASN 56 ? ? LA A LA 105 ? ? 1.57 47 9 O A LEU 49 ? ? H A LEU 53 ? ? 1.60 48 9 CG A ASN 56 ? ? LA A LA 105 ? ? 1.65 49 10 O A SER 24 ? ? H A LEU 28 ? ? 1.56 50 10 O A GLU 48 ? ? H A GLU 52 ? ? 1.58 51 10 O A LEU 49 ? ? H A LEU 53 ? ? 1.59 52 10 H A LYS 55 ? ? OE2 A GLU 65 ? ? 1.60 53 11 H A LEU 23 ? ? O A VAL 61 ? ? 1.48 54 11 H A ASN 56 ? ? OE2 A GLU 65 ? ? 1.51 55 11 O A LEU 46 ? ? H A PHE 50 ? ? 1.51 56 11 OD2 A ASP 58 ? ? LA A LA 105 ? ? 1.52 57 11 O A GLU 48 ? ? H A GLU 52 ? ? 1.58 58 11 O A SER 24 ? ? H A LEU 28 ? ? 1.59 59 11 O A LEU 49 ? ? H A LEU 53 ? ? 1.59 60 11 CG A ASP 58 ? ? LA A LA 105 ? ? 2.01 61 11 OD1 A ASP 58 ? ? LA A LA 105 ? ? 2.12 62 12 O A LEU 46 ? ? H A PHE 50 ? ? 1.52 63 12 O A SER 24 ? ? H A LEU 28 ? ? 1.57 64 13 O A SER 24 ? ? H A LEU 28 ? ? 1.57 65 13 O A LEU 49 ? ? H A LEU 53 ? ? 1.59 66 14 O A SER 24 ? ? H A LEU 28 ? ? 1.56 67 14 O A LEU 49 ? ? H A LEU 53 ? ? 1.60 68 15 O A SER 24 ? ? H A LEU 28 ? ? 1.57 69 16 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.85 70 16 O A LEU 46 ? ? H A PHE 50 ? ? 1.56 71 16 O A SER 24 ? ? H A LEU 28 ? ? 1.57 72 16 O A GLY 8 ? ? H A LYS 12 ? ? 1.58 73 16 O A LEU 28 ? ? H A LEU 32 ? ? 1.59 74 16 O A LEU 49 ? ? H A LEU 53 ? ? 1.60 75 16 ND2 A ASN 56 ? ? LA A LA 105 ? ? 1.67 76 17 O A SER 24 ? ? H A LEU 28 ? ? 1.55 77 17 OE2 A GLU 65 ? ? LA A LA 105 ? ? 1.86 78 18 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.68 79 18 ND2 A ASN 56 ? ? LA A LA 105 ? ? 0.81 80 18 HD21 A ASN 56 ? ? LA A LA 105 ? ? 1.43 81 18 O A SER 24 ? ? H A LEU 28 ? ? 1.55 82 18 CG A ASN 56 ? ? LA A LA 105 ? ? 1.87 83 18 O A GLU 60 ? ? LA A LA 105 ? ? 2.02 84 19 HD22 A ASN 56 ? ? LA A LA 105 ? ? 1.12 85 19 O A SER 24 ? ? H A LEU 28 ? ? 1.56 86 19 O A LEU 49 ? ? H A LEU 53 ? ? 1.58 87 19 ND2 A ASN 56 ? ? LA A LA 105 ? ? 1.93 88 20 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.67 89 20 ND2 A ASN 56 ? ? LA A LA 105 ? ? 1.15 90 20 O A GLU 48 ? ? H A GLU 52 ? ? 1.54 91 20 O A SER 24 ? ? H A LEU 28 ? ? 1.58 92 20 CG A ASN 56 ? ? LA A LA 105 ? ? 1.69 93 20 OD1 A ASN 56 ? ? LA A LA 105 ? ? 1.94 94 21 O A LYS 71 ? ? HG A SER 74 ? ? 1.42 95 21 O A SER 24 ? ? H A LEU 28 ? ? 1.55 96 21 O A GLU 48 ? ? H A GLU 52 ? ? 1.57 97 21 O A LEU 28 ? ? H A LEU 32 ? ? 1.59 98 21 OD1 A ASP 58 ? ? LA A LA 105 ? ? 2.08 99 22 HD22 A ASN 56 ? ? LA A LA 105 ? ? 1.22 100 22 O A SER 24 ? ? H A LEU 28 ? ? 1.54 101 22 ND2 A ASN 56 ? ? LA A LA 105 ? ? 2.02 102 23 O A SER 24 ? ? H A LEU 28 ? ? 1.58 103 23 O A LEU 49 ? ? H A LEU 53 ? ? 1.59 104 24 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.87 105 24 ND2 A ASN 56 ? ? LA A LA 105 ? ? 1.43 106 24 O A SER 24 ? ? H A LEU 28 ? ? 1.52 107 24 O A LEU 49 ? ? H A LEU 53 ? ? 1.58 108 24 O A PHE 10 ? ? H A ALA 14 ? ? 1.60 109 25 O A SER 24 ? ? H A LEU 28 ? ? 1.56 110 26 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.57 111 26 ND2 A ASN 56 ? ? LA A LA 105 ? ? 0.95 112 26 H A LEU 23 ? ? O A VAL 61 ? ? 1.47 113 26 O A SER 24 ? ? H A LEU 28 ? ? 1.56 114 26 O A GLU 48 ? ? H A GLU 52 ? ? 1.58 115 26 O A LEU 49 ? ? H A LEU 53 ? ? 1.58 116 26 CG A ASN 56 ? ? LA A LA 105 ? ? 1.66 117 26 OD1 A ASN 56 ? ? LA A LA 105 ? ? 2.08 118 27 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.82 119 27 ND2 A ASN 56 ? ? LA A LA 105 ? ? 1.34 120 27 O A SER 24 ? ? H A LEU 28 ? ? 1.55 121 27 CG A ASN 56 ? ? LA A LA 105 ? ? 1.84 122 27 OD1 A ASN 56 ? ? LA A LA 105 ? ? 2.01 123 28 O A SER 24 ? ? H A LEU 28 ? ? 1.57 124 28 O A LEU 49 ? ? H A LEU 53 ? ? 1.59 125 29 O A SER 24 ? ? H A LEU 28 ? ? 1.59 126 30 HD22 A ASN 56 ? ? LA A LA 105 ? ? 0.89 127 30 O A LEU 46 ? ? H A PHE 50 ? ? 1.51 128 30 ND2 A ASN 56 ? ? LA A LA 105 ? ? 1.52 129 30 OD1 A ASP 19 ? ? HD21 A ASN 21 ? ? 1.54 130 30 O A SER 24 ? ? H A LEU 28 ? ? 1.55 131 30 O A LEU 49 ? ? H A LEU 53 ? ? 1.59 132 30 CG A ASN 56 ? ? LA A LA 105 ? ? 1.96 133 30 OD1 A ASN 56 ? ? LA A LA 105 ? ? 2.00 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -59.96 176.32 2 1 ASP A 58 ? ? -134.46 -57.11 3 1 VAL A 61 ? ? -102.23 52.46 4 1 SER A 62 ? ? -43.26 165.55 5 2 PHE A 36 ? ? -151.46 89.77 6 3 SER A 2 ? ? -59.92 175.15 7 3 PHE A 36 ? ? -151.17 88.75 8 4 PHE A 36 ? ? -151.55 89.38 9 4 ASP A 58 ? ? -131.35 -54.55 10 4 VAL A 61 ? ? -101.77 51.12 11 4 SER A 62 ? ? -46.04 164.41 12 5 SER A 2 ? ? -59.90 174.77 13 5 ASP A 58 ? ? -142.37 -68.82 14 5 SER A 62 ? ? -46.35 172.06 15 6 PHE A 36 ? ? -151.57 89.27 16 6 LYS A 55 ? ? -168.46 -42.40 17 6 ASP A 58 ? ? -137.40 -52.58 18 6 VAL A 61 ? ? -97.07 52.40 19 6 SER A 62 ? ? -47.08 165.88 20 7 SER A 2 ? ? -59.86 173.97 21 7 PHE A 36 ? ? -151.80 89.20 22 7 ASP A 58 ? ? -131.56 -55.82 23 7 VAL A 61 ? ? -103.83 58.79 24 8 ASP A 58 ? ? -134.50 -58.63 25 8 VAL A 61 ? ? -97.38 57.78 26 8 SER A 62 ? ? -48.79 166.34 27 9 SER A 2 ? ? -59.98 175.18 28 9 PHE A 36 ? ? -151.47 88.98 29 9 ASP A 58 ? ? -129.60 -56.42 30 9 VAL A 61 ? ? -102.98 62.58 31 9 SER A 62 ? ? -49.25 179.81 32 10 PHE A 36 ? ? -151.27 88.78 33 10 ASP A 58 ? ? -133.36 -48.53 34 10 VAL A 61 ? ? -100.47 59.21 35 10 SER A 62 ? ? -48.77 173.02 36 11 PHE A 36 ? ? -151.45 89.02 37 11 THR A 45 ? ? -59.94 170.08 38 11 ASP A 54 ? ? -68.17 74.02 39 12 PHE A 36 ? ? -151.65 89.09 40 12 ASP A 58 ? ? -134.91 -51.73 41 13 LYS A 41 ? ? -94.56 57.60 42 13 LYS A 55 ? ? -178.36 -37.36 43 13 ASP A 58 ? ? -135.68 -51.52 44 13 VAL A 61 ? ? -98.51 53.32 45 13 SER A 62 ? ? -46.19 164.86 46 14 PHE A 36 ? ? -151.55 89.13 47 14 THR A 45 ? ? -59.90 170.08 48 14 ASP A 54 ? ? -69.84 68.83 49 14 ASP A 58 ? ? -124.56 -52.62 50 14 VAL A 61 ? ? -100.86 48.37 51 14 SER A 62 ? ? -43.22 163.71 52 15 PHE A 36 ? ? -151.69 88.70 53 15 ASP A 58 ? ? -136.77 -51.37 54 15 VAL A 61 ? ? -97.95 57.50 55 16 LYS A 55 ? ? -165.17 -42.97 56 16 ASP A 58 ? ? -133.63 -52.71 57 16 VAL A 61 ? ? -97.53 52.11 58 16 SER A 62 ? ? -46.53 164.56 59 17 LYS A 55 ? ? -164.42 -43.51 60 17 ASP A 58 ? ? -127.86 -52.43 61 17 SER A 62 ? ? -48.29 176.20 62 18 ASP A 54 ? ? -69.70 72.54 63 18 ASP A 58 ? ? -125.29 -55.59 64 18 SER A 62 ? ? 65.35 157.99 65 19 PHE A 36 ? ? -151.00 88.64 66 19 LYS A 55 ? ? -175.17 -39.53 67 19 ASP A 58 ? ? -133.14 -54.09 68 19 VAL A 61 ? ? -99.32 59.34 69 20 PHE A 36 ? ? -150.81 88.70 70 20 LYS A 41 ? ? -90.52 53.11 71 20 THR A 45 ? ? -59.48 170.63 72 20 ASP A 58 ? ? -138.06 -48.86 73 20 VAL A 61 ? ? -97.23 57.00 74 20 SER A 62 ? ? -49.19 166.65 75 21 PHE A 36 ? ? -151.46 89.92 76 21 ASP A 54 ? ? -66.06 85.51 77 21 ASP A 58 ? ? -129.58 -56.23 78 21 VAL A 61 ? ? -105.85 61.05 79 21 SER A 62 ? ? -50.13 179.76 80 22 PHE A 36 ? ? -151.47 89.59 81 22 LYS A 55 ? ? -169.95 -41.78 82 22 ASP A 58 ? ? -134.19 -52.22 83 22 VAL A 61 ? ? -94.95 59.19 84 22 SER A 62 ? ? -44.94 169.33 85 23 PHE A 36 ? ? -151.76 89.09 86 23 ASP A 58 ? ? -132.68 -84.68 87 23 VAL A 61 ? ? -92.29 50.80 88 23 SER A 62 ? ? -43.97 164.84 89 24 PHE A 36 ? ? -151.37 89.38 90 24 ASP A 58 ? ? -143.68 -50.08 91 24 VAL A 61 ? ? -112.95 52.45 92 24 SER A 62 ? ? -44.23 165.95 93 25 PHE A 36 ? ? -151.62 89.10 94 25 LYS A 55 ? ? -173.29 -40.64 95 25 ASP A 58 ? ? -132.86 -54.06 96 25 VAL A 61 ? ? -100.11 59.20 97 25 SER A 62 ? ? -46.96 172.54 98 26 PHE A 36 ? ? -150.94 89.13 99 26 THR A 45 ? ? -59.83 170.45 100 26 ASP A 54 ? ? -68.66 66.67 101 27 PHE A 36 ? ? -151.44 89.92 102 27 ASP A 58 ? ? -126.00 -60.14 103 27 VAL A 61 ? ? -100.94 60.55 104 27 SER A 62 ? ? -46.25 170.22 105 28 PHE A 36 ? ? -151.38 88.63 106 28 THR A 45 ? ? -59.63 170.76 107 28 ASP A 58 ? ? -143.06 -68.54 108 28 VAL A 61 ? ? -91.80 50.43 109 28 SER A 62 ? ? -43.24 165.09 110 29 PHE A 36 ? ? -151.17 89.51 111 29 ASP A 58 ? ? -137.37 -50.50 112 29 VAL A 61 ? ? -97.17 54.47 113 29 SER A 62 ? ? -48.58 166.16 114 30 SER A 2 ? ? -59.85 175.73 115 30 PHE A 36 ? ? -151.40 89.44 116 30 ASP A 58 ? ? -131.14 -52.52 117 30 SER A 62 ? ? -50.31 178.10 # _pdbx_nmr_ensemble.entry_id 1KQV _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1KQV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.0 mM Ca Ln Cb' _pdbx_nmr_sample_details.solvent_system 'H2O/D2O 10:1' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 1 6.0 'water solution' atm K 2 283 1 6.0 'water solution' atm K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 HNHA 3 1 2 HNHA 4 1 1 HNCA 5 1 1 HNCO 6 1 1 HNHB 7 1 1 IR-HSQC # _pdbx_nmr_details.entry_id 1KQV _pdbx_nmr_details.text 'This strucure was determined using both standard and tailored NMR experiments in order to detect paramagnetic signals.' # _pdbx_nmr_refine.entry_id 1KQV _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal PSEUDYANA 3.1 'structure solution' 'Banci, L., Bertini, I., Cremonini, M.A., Gori Savellini, G., Luchinat, C., Wuthrich, K. and Guntert, P.' 1 PSEUDYANA 3.1 refinement 'Banci, L., Bertini, I., Cremonini, M.A., Gori Savellini, G., Luchinat, C., Wuthrich, K. and Guntert, P.' 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -3 ? A MET 1 2 1 Y 1 A SER -2 ? A SER 2 3 1 Y 1 A ALA -1 ? A ALA 3 4 1 Y 1 A LYS 0 ? A LYS 4 5 2 Y 1 A MET -3 ? A MET 1 6 2 Y 1 A SER -2 ? A SER 2 7 2 Y 1 A ALA -1 ? A ALA 3 8 2 Y 1 A LYS 0 ? A LYS 4 9 3 Y 1 A MET -3 ? A MET 1 10 3 Y 1 A SER -2 ? A SER 2 11 3 Y 1 A ALA -1 ? A ALA 3 12 3 Y 1 A LYS 0 ? A LYS 4 13 4 Y 1 A MET -3 ? A MET 1 14 4 Y 1 A SER -2 ? A SER 2 15 4 Y 1 A ALA -1 ? A ALA 3 16 4 Y 1 A LYS 0 ? A LYS 4 17 5 Y 1 A MET -3 ? A MET 1 18 5 Y 1 A SER -2 ? A SER 2 19 5 Y 1 A ALA -1 ? A ALA 3 20 5 Y 1 A LYS 0 ? A LYS 4 21 6 Y 1 A MET -3 ? A MET 1 22 6 Y 1 A SER -2 ? A SER 2 23 6 Y 1 A ALA -1 ? A ALA 3 24 6 Y 1 A LYS 0 ? A LYS 4 25 7 Y 1 A MET -3 ? A MET 1 26 7 Y 1 A SER -2 ? A SER 2 27 7 Y 1 A ALA -1 ? A ALA 3 28 7 Y 1 A LYS 0 ? A LYS 4 29 8 Y 1 A MET -3 ? A MET 1 30 8 Y 1 A SER -2 ? A SER 2 31 8 Y 1 A ALA -1 ? A ALA 3 32 8 Y 1 A LYS 0 ? A LYS 4 33 9 Y 1 A MET -3 ? A MET 1 34 9 Y 1 A SER -2 ? A SER 2 35 9 Y 1 A ALA -1 ? A ALA 3 36 9 Y 1 A LYS 0 ? A LYS 4 37 10 Y 1 A MET -3 ? A MET 1 38 10 Y 1 A SER -2 ? A SER 2 39 10 Y 1 A ALA -1 ? A ALA 3 40 10 Y 1 A LYS 0 ? A LYS 4 41 11 Y 1 A MET -3 ? A MET 1 42 11 Y 1 A SER -2 ? A SER 2 43 11 Y 1 A ALA -1 ? A ALA 3 44 11 Y 1 A LYS 0 ? A LYS 4 45 12 Y 1 A MET -3 ? A MET 1 46 12 Y 1 A SER -2 ? A SER 2 47 12 Y 1 A ALA -1 ? A ALA 3 48 12 Y 1 A LYS 0 ? A LYS 4 49 13 Y 1 A MET -3 ? A MET 1 50 13 Y 1 A SER -2 ? A SER 2 51 13 Y 1 A ALA -1 ? A ALA 3 52 13 Y 1 A LYS 0 ? A LYS 4 53 14 Y 1 A MET -3 ? A MET 1 54 14 Y 1 A SER -2 ? A SER 2 55 14 Y 1 A ALA -1 ? A ALA 3 56 14 Y 1 A LYS 0 ? A LYS 4 57 15 Y 1 A MET -3 ? A MET 1 58 15 Y 1 A SER -2 ? A SER 2 59 15 Y 1 A ALA -1 ? A ALA 3 60 15 Y 1 A LYS 0 ? A LYS 4 61 16 Y 1 A MET -3 ? A MET 1 62 16 Y 1 A SER -2 ? A SER 2 63 16 Y 1 A ALA -1 ? A ALA 3 64 16 Y 1 A LYS 0 ? A LYS 4 65 17 Y 1 A MET -3 ? A MET 1 66 17 Y 1 A SER -2 ? A SER 2 67 17 Y 1 A ALA -1 ? A ALA 3 68 17 Y 1 A LYS 0 ? A LYS 4 69 18 Y 1 A MET -3 ? A MET 1 70 18 Y 1 A SER -2 ? A SER 2 71 18 Y 1 A ALA -1 ? A ALA 3 72 18 Y 1 A LYS 0 ? A LYS 4 73 19 Y 1 A MET -3 ? A MET 1 74 19 Y 1 A SER -2 ? A SER 2 75 19 Y 1 A ALA -1 ? A ALA 3 76 19 Y 1 A LYS 0 ? A LYS 4 77 20 Y 1 A MET -3 ? A MET 1 78 20 Y 1 A SER -2 ? A SER 2 79 20 Y 1 A ALA -1 ? A ALA 3 80 20 Y 1 A LYS 0 ? A LYS 4 81 21 Y 1 A MET -3 ? A MET 1 82 21 Y 1 A SER -2 ? A SER 2 83 21 Y 1 A ALA -1 ? A ALA 3 84 21 Y 1 A LYS 0 ? A LYS 4 85 22 Y 1 A MET -3 ? A MET 1 86 22 Y 1 A SER -2 ? A SER 2 87 22 Y 1 A ALA -1 ? A ALA 3 88 22 Y 1 A LYS 0 ? A LYS 4 89 23 Y 1 A MET -3 ? A MET 1 90 23 Y 1 A SER -2 ? A SER 2 91 23 Y 1 A ALA -1 ? A ALA 3 92 23 Y 1 A LYS 0 ? A LYS 4 93 24 Y 1 A MET -3 ? A MET 1 94 24 Y 1 A SER -2 ? A SER 2 95 24 Y 1 A ALA -1 ? A ALA 3 96 24 Y 1 A LYS 0 ? A LYS 4 97 25 Y 1 A MET -3 ? A MET 1 98 25 Y 1 A SER -2 ? A SER 2 99 25 Y 1 A ALA -1 ? A ALA 3 100 25 Y 1 A LYS 0 ? A LYS 4 101 26 Y 1 A MET -3 ? A MET 1 102 26 Y 1 A SER -2 ? A SER 2 103 26 Y 1 A ALA -1 ? A ALA 3 104 26 Y 1 A LYS 0 ? A LYS 4 105 27 Y 1 A MET -3 ? A MET 1 106 27 Y 1 A SER -2 ? A SER 2 107 27 Y 1 A ALA -1 ? A ALA 3 108 27 Y 1 A LYS 0 ? A LYS 4 109 28 Y 1 A MET -3 ? A MET 1 110 28 Y 1 A SER -2 ? A SER 2 111 28 Y 1 A ALA -1 ? A ALA 3 112 28 Y 1 A LYS 0 ? A LYS 4 113 29 Y 1 A MET -3 ? A MET 1 114 29 Y 1 A SER -2 ? A SER 2 115 29 Y 1 A ALA -1 ? A ALA 3 116 29 Y 1 A LYS 0 ? A LYS 4 117 30 Y 1 A MET -3 ? A MET 1 118 30 Y 1 A SER -2 ? A SER 2 119 30 Y 1 A ALA -1 ? A ALA 3 120 30 Y 1 A LYS 0 ? A LYS 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LA LA LA N N 118 LEU N N N N 119 LEU CA C N S 120 LEU C C N N 121 LEU O O N N 122 LEU CB C N N 123 LEU CG C N N 124 LEU CD1 C N N 125 LEU CD2 C N N 126 LEU OXT O N N 127 LEU H H N N 128 LEU H2 H N N 129 LEU HA H N N 130 LEU HB2 H N N 131 LEU HB3 H N N 132 LEU HG H N N 133 LEU HD11 H N N 134 LEU HD12 H N N 135 LEU HD13 H N N 136 LEU HD21 H N N 137 LEU HD22 H N N 138 LEU HD23 H N N 139 LEU HXT H N N 140 LYS N N N N 141 LYS CA C N S 142 LYS C C N N 143 LYS O O N N 144 LYS CB C N N 145 LYS CG C N N 146 LYS CD C N N 147 LYS CE C N N 148 LYS NZ N N N 149 LYS OXT O N N 150 LYS H H N N 151 LYS H2 H N N 152 LYS HA H N N 153 LYS HB2 H N N 154 LYS HB3 H N N 155 LYS HG2 H N N 156 LYS HG3 H N N 157 LYS HD2 H N N 158 LYS HD3 H N N 159 LYS HE2 H N N 160 LYS HE3 H N N 161 LYS HZ1 H N N 162 LYS HZ2 H N N 163 LYS HZ3 H N N 164 LYS HXT H N N 165 MET N N N N 166 MET CA C N S 167 MET C C N N 168 MET O O N N 169 MET CB C N N 170 MET CG C N N 171 MET SD S N N 172 MET CE C N N 173 MET OXT O N N 174 MET H H N N 175 MET H2 H N N 176 MET HA H N N 177 MET HB2 H N N 178 MET HB3 H N N 179 MET HG2 H N N 180 MET HG3 H N N 181 MET HE1 H N N 182 MET HE2 H N N 183 MET HE3 H N N 184 MET HXT H N N 185 PHE N N N N 186 PHE CA C N S 187 PHE C C N N 188 PHE O O N N 189 PHE CB C N N 190 PHE CG C Y N 191 PHE CD1 C Y N 192 PHE CD2 C Y N 193 PHE CE1 C Y N 194 PHE CE2 C Y N 195 PHE CZ C Y N 196 PHE OXT O N N 197 PHE H H N N 198 PHE H2 H N N 199 PHE HA H N N 200 PHE HB2 H N N 201 PHE HB3 H N N 202 PHE HD1 H N N 203 PHE HD2 H N N 204 PHE HE1 H N N 205 PHE HE2 H N N 206 PHE HZ H N N 207 PHE HXT H N N 208 PRO N N N N 209 PRO CA C N S 210 PRO C C N N 211 PRO O O N N 212 PRO CB C N N 213 PRO CG C N N 214 PRO CD C N N 215 PRO OXT O N N 216 PRO H H N N 217 PRO HA H N N 218 PRO HB2 H N N 219 PRO HB3 H N N 220 PRO HG2 H N N 221 PRO HG3 H N N 222 PRO HD2 H N N 223 PRO HD3 H N N 224 PRO HXT H N N 225 SER N N N N 226 SER CA C N S 227 SER C C N N 228 SER O O N N 229 SER CB C N N 230 SER OG O N N 231 SER OXT O N N 232 SER H H N N 233 SER H2 H N N 234 SER HA H N N 235 SER HB2 H N N 236 SER HB3 H N N 237 SER HG H N N 238 SER HXT H N N 239 THR N N N N 240 THR CA C N S 241 THR C C N N 242 THR O O N N 243 THR CB C N R 244 THR OG1 O N N 245 THR CG2 C N N 246 THR OXT O N N 247 THR H H N N 248 THR H2 H N N 249 THR HA H N N 250 THR HB H N N 251 THR HG1 H N N 252 THR HG21 H N N 253 THR HG22 H N N 254 THR HG23 H N N 255 THR HXT H N N 256 TYR N N N N 257 TYR CA C N S 258 TYR C C N N 259 TYR O O N N 260 TYR CB C N N 261 TYR CG C Y N 262 TYR CD1 C Y N 263 TYR CD2 C Y N 264 TYR CE1 C Y N 265 TYR CE2 C Y N 266 TYR CZ C Y N 267 TYR OH O N N 268 TYR OXT O N N 269 TYR H H N N 270 TYR H2 H N N 271 TYR HA H N N 272 TYR HB2 H N N 273 TYR HB3 H N N 274 TYR HD1 H N N 275 TYR HD2 H N N 276 TYR HE1 H N N 277 TYR HE2 H N N 278 TYR HH H N N 279 TYR HXT H N N 280 VAL N N N N 281 VAL CA C N S 282 VAL C C N N 283 VAL O O N N 284 VAL CB C N N 285 VAL CG1 C N N 286 VAL CG2 C N N 287 VAL OXT O N N 288 VAL H H N N 289 VAL H2 H N N 290 VAL HA H N N 291 VAL HB H N N 292 VAL HG11 H N N 293 VAL HG12 H N N 294 VAL HG13 H N N 295 VAL HG21 H N N 296 VAL HG22 H N N 297 VAL HG23 H N N 298 VAL HXT H N N 299 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 PRO N CA sing N N 198 PRO N CD sing N N 199 PRO N H sing N N 200 PRO CA C sing N N 201 PRO CA CB sing N N 202 PRO CA HA sing N N 203 PRO C O doub N N 204 PRO C OXT sing N N 205 PRO CB CG sing N N 206 PRO CB HB2 sing N N 207 PRO CB HB3 sing N N 208 PRO CG CD sing N N 209 PRO CG HG2 sing N N 210 PRO CG HG3 sing N N 211 PRO CD HD2 sing N N 212 PRO CD HD3 sing N N 213 PRO OXT HXT sing N N 214 SER N CA sing N N 215 SER N H sing N N 216 SER N H2 sing N N 217 SER CA C sing N N 218 SER CA CB sing N N 219 SER CA HA sing N N 220 SER C O doub N N 221 SER C OXT sing N N 222 SER CB OG sing N N 223 SER CB HB2 sing N N 224 SER CB HB3 sing N N 225 SER OG HG sing N N 226 SER OXT HXT sing N N 227 THR N CA sing N N 228 THR N H sing N N 229 THR N H2 sing N N 230 THR CA C sing N N 231 THR CA CB sing N N 232 THR CA HA sing N N 233 THR C O doub N N 234 THR C OXT sing N N 235 THR CB OG1 sing N N 236 THR CB CG2 sing N N 237 THR CB HB sing N N 238 THR OG1 HG1 sing N N 239 THR CG2 HG21 sing N N 240 THR CG2 HG22 sing N N 241 THR CG2 HG23 sing N N 242 THR OXT HXT sing N N 243 TYR N CA sing N N 244 TYR N H sing N N 245 TYR N H2 sing N N 246 TYR CA C sing N N 247 TYR CA CB sing N N 248 TYR CA HA sing N N 249 TYR C O doub N N 250 TYR C OXT sing N N 251 TYR CB CG sing N N 252 TYR CB HB2 sing N N 253 TYR CB HB3 sing N N 254 TYR CG CD1 doub Y N 255 TYR CG CD2 sing Y N 256 TYR CD1 CE1 sing Y N 257 TYR CD1 HD1 sing N N 258 TYR CD2 CE2 doub Y N 259 TYR CD2 HD2 sing N N 260 TYR CE1 CZ doub Y N 261 TYR CE1 HE1 sing N N 262 TYR CE2 CZ sing Y N 263 TYR CE2 HE2 sing N N 264 TYR CZ OH sing N N 265 TYR OH HH sing N N 266 TYR OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 500 2 ? Bruker AVANCE 600 3 ? Bruker AVANCE 800 4 ? Bruker AVANCE 700 # _atom_sites.entry_id 1KQV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H LA N O S # loop_