data_1KVV # _entry.id 1KVV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KVV pdb_00001kvv 10.2210/pdb1kvv/pdb RCSB RCSB015389 ? ? WWPDB D_1000015389 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 4935 'Deposition 4935 contains assignments for protein SRP19 of Archaeoglobus fulgidus.' unspecified PDB 1KVN '1KVN contains the coordinates for the ensemble of the ten lowest energy structures for the same protein.' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KVV _pdbx_database_status.recvd_initial_deposition_date 2002-01-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pakhomova, O.N.' 1 'Deep, S.' 2 'Huang, Q.' 3 'Zwieb, C.' 4 'Hinck, A.P.' 5 # _citation.id primary _citation.title 'Solution structure of protein SRP19 of Archaeoglobus fulgidus signal recognition particle.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 317 _citation.page_first 145 _citation.page_last 158 _citation.year 2002 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11916385 _citation.pdbx_database_id_DOI 10.1006/jmbi.2002.5411 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pakhomova, O.N.' 1 ? primary 'Deep, S.' 2 ? primary 'Huang, Q.' 3 ? primary 'Zwieb, C.' 4 ? primary 'Hinck, A.P.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description SRP19 _entity.formula_weight 12406.707 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C4S/C41S _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKESVVWTVNLDSKKSRAEGRRIPRRFAVPNVKLHELVEASKELGLKFRAEEKKYPKSWWEEGGRVVVEKRGTKTKLMIE LARKIAEIREQKREQKKDKKKKKK ; _entity_poly.pdbx_seq_one_letter_code_can ;MKESVVWTVNLDSKKSRAEGRRIPRRFAVPNVKLHELVEASKELGLKFRAEEKKYPKSWWEEGGRVVVEKRGTKTKLMIE LARKIAEIREQKREQKKDKKKKKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 SER n 1 5 VAL n 1 6 VAL n 1 7 TRP n 1 8 THR n 1 9 VAL n 1 10 ASN n 1 11 LEU n 1 12 ASP n 1 13 SER n 1 14 LYS n 1 15 LYS n 1 16 SER n 1 17 ARG n 1 18 ALA n 1 19 GLU n 1 20 GLY n 1 21 ARG n 1 22 ARG n 1 23 ILE n 1 24 PRO n 1 25 ARG n 1 26 ARG n 1 27 PHE n 1 28 ALA n 1 29 VAL n 1 30 PRO n 1 31 ASN n 1 32 VAL n 1 33 LYS n 1 34 LEU n 1 35 HIS n 1 36 GLU n 1 37 LEU n 1 38 VAL n 1 39 GLU n 1 40 ALA n 1 41 SER n 1 42 LYS n 1 43 GLU n 1 44 LEU n 1 45 GLY n 1 46 LEU n 1 47 LYS n 1 48 PHE n 1 49 ARG n 1 50 ALA n 1 51 GLU n 1 52 GLU n 1 53 LYS n 1 54 LYS n 1 55 TYR n 1 56 PRO n 1 57 LYS n 1 58 SER n 1 59 TRP n 1 60 TRP n 1 61 GLU n 1 62 GLU n 1 63 GLY n 1 64 GLY n 1 65 ARG n 1 66 VAL n 1 67 VAL n 1 68 VAL n 1 69 GLU n 1 70 LYS n 1 71 ARG n 1 72 GLY n 1 73 THR n 1 74 LYS n 1 75 THR n 1 76 LYS n 1 77 LEU n 1 78 MET n 1 79 ILE n 1 80 GLU n 1 81 LEU n 1 82 ALA n 1 83 ARG n 1 84 LYS n 1 85 ILE n 1 86 ALA n 1 87 GLU n 1 88 ILE n 1 89 ARG n 1 90 GLU n 1 91 GLN n 1 92 LYS n 1 93 ARG n 1 94 GLU n 1 95 GLN n 1 96 LYS n 1 97 LYS n 1 98 ASP n 1 99 LYS n 1 100 LYS n 1 101 LYS n 1 102 LYS n 1 103 LYS n 1 104 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Archaeoglobus _entity_src_gen.pdbx_gene_src_gene AF1258 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Archaeoglobus fulgidus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2234 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-23c(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SRP19_ARCFU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKECVVWTVNLDSKKSRAEGRRIPRRFAVPNVKLHELVEACKELGLKFRAEEKKYPKSWWEEGGRVVVEKRGTKTKLMIE LARKIAEIREQKREQKKDKKKKKK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession O29010 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KVV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O29010 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KVV SER A 4 ? UNP O29010 CYS 4 'engineered mutation' 4 1 1 1KVV SER A 41 ? UNP O29010 CYS 41 'engineered mutation' 41 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY 3 2 1 4D_13C-separated_NOESY 4 1 1 '3D 15N-separated NOESY with 13C chemical shift evolution in F2 dimension' 5 1 2 IPAP-HSQC # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 ambient 6.0 '75 mM' ? K 2 310 ambient 6.0 '75 mM' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '25mM KH2PO4, 50mM NaCl, 95% H2O, 5% D2O' '95% H2O/5% D2O' 2 '25mM KH2PO4, 50mM NaCl, 99.99% D2O' '99.99% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AMX2 _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1KVV _pdbx_nmr_refine.method 'Distance geometry/simulated annealing protocol' _pdbx_nmr_refine.details ;The structures are based on a total of 886 restraints, 690 are NOE-derived distance constraints, 130 dihegral angle restraints, 66 1H-15N residual dipolar coupling restraints. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1KVV _pdbx_nmr_details.text ;IPAP-HSQC experiment was performed in a sample of the protein in either an unstressed or mechanically stressed 8% polyacrylamide gel. ; # _pdbx_nmr_ensemble.entry_id 1KVV _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1KVV _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.5 collection 'Bruker analytic GmbH' 1 NMRPipe 1.8 processing 'Delaglio,F., Grzesiek, S., Vuister, G., Zhu, W., Pfeifer, J., Bax, A.' 2 PIPP 4.3.1 'data analysis' 'Garrett, D. C., Powers, R., Gronenborn, A.M., Clore, G. M.' 3 X-PLOR 3.851 'structure solution' 'Brunger, A. T.; Clore, G.M., Gronenborn, A.M., Tjundra, N.' 4 TALOS 98.040.28.02 'data analysis' 'Cornilescu, G., Delaglio, F., Bax, A.' 5 PALES 2.1 'data analysis' 'Zweckstetter, M., Bax, A.' 6 X-PLOR 3.851 refinement 'Brunger, A.T.; Clore, G.M., Gronenborn, A.M., Tjundra, N.' 7 # _exptl.entry_id 1KVV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1KVV _struct.title 'Solution Structure Of Protein SRP19 Of The Archaeoglobus fulgidus Signal Recognition Particle, Minimized Average Structure' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1KVV _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RNA binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 33 ? GLY A 45 ? LYS A 33 GLY A 45 1 ? 13 HELX_P HELX_P2 2 LYS A 74 ? GLN A 95 ? LYS A 74 GLN A 95 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 4 ? TRP A 7 ? SER A 4 TRP A 7 A 2 ARG A 65 ? VAL A 68 ? ARG A 65 VAL A 68 A 3 PHE A 48 ? GLU A 51 ? PHE A 48 GLU A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 6 ? N VAL A 6 O VAL A 66 ? O VAL A 66 A 2 3 O ARG A 65 ? O ARG A 65 N GLU A 51 ? N GLU A 51 # _database_PDB_matrix.entry_id 1KVV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KVV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LYS 104 104 104 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-03-20 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ALA 82 ? ? H A ALA 86 ? ? 1.50 2 1 O A LEU 77 ? ? H A LEU 81 ? ? 1.50 3 1 O A LYS 47 ? ? H A GLU 69 ? ? 1.55 4 1 H A GLU 51 ? ? O A ARG 65 ? ? 1.56 5 1 H A ARG 49 ? ? O A VAL 67 ? ? 1.56 6 1 O A MET 78 ? ? H A ALA 82 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -117.87 -155.85 2 1 ASN A 31 ? ? 72.58 110.26 3 1 LEU A 46 ? ? 178.96 96.59 4 1 LYS A 47 ? ? -149.08 -42.48 5 1 LYS A 53 ? ? -43.59 153.51 6 1 TRP A 60 ? ? 57.50 77.84 7 1 LYS A 70 ? ? -178.13 -61.06 8 1 ARG A 71 ? ? 53.86 170.49 9 1 LYS A 74 ? ? -121.15 -94.90 10 1 LYS A 97 ? ? 52.21 19.99 11 1 ASP A 98 ? ? -138.71 -45.38 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 17 ? ? 0.297 'SIDE CHAIN' 2 1 ARG A 21 ? ? 0.316 'SIDE CHAIN' 3 1 ARG A 22 ? ? 0.199 'SIDE CHAIN' 4 1 ARG A 25 ? ? 0.266 'SIDE CHAIN' 5 1 ARG A 26 ? ? 0.215 'SIDE CHAIN' 6 1 ARG A 49 ? ? 0.299 'SIDE CHAIN' 7 1 ARG A 65 ? ? 0.166 'SIDE CHAIN' 8 1 ARG A 71 ? ? 0.317 'SIDE CHAIN' 9 1 ARG A 83 ? ? 0.160 'SIDE CHAIN' 10 1 ARG A 89 ? ? 0.259 'SIDE CHAIN' 11 1 ARG A 93 ? ? 0.242 'SIDE CHAIN' #