data_1KWJ # _entry.id 1KWJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KWJ pdb_00001kwj 10.2210/pdb1kwj/pdb RCSB RCSB015409 ? ? WWPDB D_1000015409 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-02-06 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_conn_type 9 4 'Structure model' struct_ref_seq_dif 10 4 'Structure model' struct_site 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' pdbx_entry_details 14 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.conn_type_id' 15 4 'Structure model' '_struct_conn.id' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn_type.id' 27 4 'Structure model' '_struct_ref_seq_dif.details' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'CHIRALITY ERROR AT CA CENTER OF ALA A 1' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KWJ _pdbx_database_status.recvd_initial_deposition_date 2002-01-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1EHJ ;1EHJ contains the energy minimized average solution structure of the fully reduced native cytochrome c7 from Desulfuromonas acetoxidans ; unspecified PDB 1F22 '1F22 contains the 35 solution structures family of the fully reduced native cytochrome c7 from Desulfuromonas acetoxidans' unspecified PDB 1new '1new contains 18 solution structures of the fully oxidized native cytochrome c7 from Desulfuromonas acetoxidans' unspecified PDB 2new '2new contains 17 solution structures of the fully oxidized native cytochrome c7 from Desulfuromonas acetoxidans' unspecified PDB 1HH5 '1HH5 contains the X-ray structure of the fully oxidized native cytochrome c7 from Desulfuromonas acetoxidans' unspecified PDB 1L3O 'CONTAINS THE RELATED 35 STRUCTURE ENSEMBLE' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Assfalg, M.' 1 'Bertini, I.' 2 'Turano, P.' 3 'Bruschi, M.' 4 'Durand, M.C.' 5 'Giudici-Orticoni, M.T.' 6 'Dolla, A.' 7 # _citation.id primary _citation.title ;A quick solution structure determination of the fully oxidized double mutant K9-10A cytochrome c7 from Desulfuromonas acetoxidans and mechanistic implications. ; _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 22 _citation.page_first 107 _citation.page_last 122 _citation.year 2002 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11883773 _citation.pdbx_database_id_DOI 10.1023/A:1014202405862 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Assfalg, M.' 1 ? primary 'Bertini, I.' 2 ? primary 'Turano, P.' 3 ? primary 'Bruschi, M.' 4 ? primary 'Durand, M.C.' 5 ? primary 'Giudici-Orticoni, M.T.' 6 ? primary 'Dolla, A.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cytochrome c7' 7164.105 1 ? 'K9A, K10A' ? ? 2 non-polymer syn 'HEME C' 618.503 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytochrome c3, Cytochrome c551.5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADVVTYENAAGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK _entity_poly.pdbx_seq_one_letter_code_can ADVVTYENAAGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 VAL n 1 4 VAL n 1 5 THR n 1 6 TYR n 1 7 GLU n 1 8 ASN n 1 9 ALA n 1 10 ALA n 1 11 GLY n 1 12 ASN n 1 13 VAL n 1 14 THR n 1 15 PHE n 1 16 ASP n 1 17 HIS n 1 18 LYS n 1 19 ALA n 1 20 HIS n 1 21 ALA n 1 22 GLU n 1 23 LYS n 1 24 LEU n 1 25 GLY n 1 26 CYS n 1 27 ASP n 1 28 ALA n 1 29 CYS n 1 30 HIS n 1 31 GLU n 1 32 GLY n 1 33 THR n 1 34 PRO n 1 35 ALA n 1 36 LYS n 1 37 ILE n 1 38 ALA n 1 39 ILE n 1 40 ASP n 1 41 LYS n 1 42 LYS n 1 43 SER n 1 44 ALA n 1 45 HIS n 1 46 LYS n 1 47 ASP n 1 48 ALA n 1 49 CYS n 1 50 LYS n 1 51 THR n 1 52 CYS n 1 53 HIS n 1 54 LYS n 1 55 SER n 1 56 ASN n 1 57 ASN n 1 58 GLY n 1 59 PRO n 1 60 THR n 1 61 LYS n 1 62 CYS n 1 63 GLY n 1 64 GLY n 1 65 CYS n 1 66 HIS n 1 67 ILE n 1 68 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Desulfuromonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Desulfuromonas acetoxidans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 891 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Desulfovibrio desulfuricans' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 876 _entity_src_gen.host_org_genus Desulfovibrio _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain G201 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LYS 68 68 68 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 130 30 HEC HEM A . C 2 HEC 1 153 53 HEC HEM A . D 2 HEC 1 166 66 HEC HEM A . # _exptl.entry_id 1KWJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1KWJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1KWJ _struct.title ;solution structure determination of the fully oxidized double mutant K9-10A cytochrome c7 from Desulfuromonas acetoxidans, minimized average structure ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KWJ _struct_keywords.pdbx_keywords 'OXYGEN STORAGE/TRANSPORT' _struct_keywords.text ;automatic assignment, cytochrome c7, electron transfer, multiheme cytochromes, NMR solution structure, OXYGEN STORAGE-TRANSPORT COMPLEX ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYC3_DESAC _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P00137 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KWJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00137 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KWJ ALA A 9 ? UNP P00137 LYS 9 'engineered mutation' 9 1 1 1KWJ ALA A 10 ? UNP P00137 LYS 10 'engineered mutation' 10 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 17 ? GLY A 25 ? HIS A 17 GLY A 25 1 ? 9 HELX_P HELX_P2 2 CYS A 26 ? HIS A 30 ? CYS A 26 HIS A 30 5 ? 5 HELX_P HELX_P3 3 LYS A 42 ? ASP A 47 ? LYS A 42 ASP A 47 1 ? 6 HELX_P HELX_P4 4 CYS A 49 ? ASN A 56 ? CYS A 49 ASN A 56 1 ? 8 HELX_P HELX_P5 5 LYS A 61 ? HIS A 66 ? LYS A 61 HIS A 66 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 26 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 26 A HEC 130 1_555 ? ? ? ? ? ? ? 1.813 ? ? covale2 covale none ? A CYS 29 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 29 A HEC 130 1_555 ? ? ? ? ? ? ? 1.817 ? ? covale3 covale none ? A CYS 49 SG ? ? ? 1_555 C HEC . CAB ? ? A CYS 49 A HEC 153 1_555 ? ? ? ? ? ? ? 1.824 ? ? covale4 covale none ? A CYS 52 SG ? ? ? 1_555 C HEC . CAC ? ? A CYS 52 A HEC 153 1_555 ? ? ? ? ? ? ? 1.812 ? ? covale5 covale none ? A CYS 62 SG ? ? ? 1_555 D HEC . CAB ? ? A CYS 62 A HEC 166 1_555 ? ? ? ? ? ? ? 1.816 ? ? covale6 covale none ? A CYS 65 SG ? ? ? 1_555 D HEC . CAC ? ? A CYS 65 A HEC 166 1_555 ? ? ? ? ? ? ? 1.817 ? ? metalc1 metalc ? ? A HIS 17 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 17 A HEC 130 1_555 ? ? ? ? ? ? ? 1.975 ? ? metalc2 metalc ? ? A HIS 20 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 20 A HEC 153 1_555 ? ? ? ? ? ? ? 1.989 ? ? metalc3 metalc ? ? A HIS 30 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 30 A HEC 130 1_555 ? ? ? ? ? ? ? 1.986 ? ? metalc4 metalc ? ? A HIS 45 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 45 A HEC 166 1_555 ? ? ? ? ? ? ? 1.977 ? ? metalc5 metalc ? ? A HIS 53 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 53 A HEC 153 1_555 ? ? ? ? ? ? ? 2.011 ? ? metalc6 metalc ? ? A HIS 66 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 66 A HEC 166 1_555 ? ? ? ? ? ? ? 1.986 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 17 ? A HIS 17 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NA ? B HEC . ? A HEC 130 ? 1_555 91.4 ? 2 NE2 ? A HIS 17 ? A HIS 17 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NB ? B HEC . ? A HEC 130 ? 1_555 92.4 ? 3 NA ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NB ? B HEC . ? A HEC 130 ? 1_555 92.8 ? 4 NE2 ? A HIS 17 ? A HIS 17 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NC ? B HEC . ? A HEC 130 ? 1_555 88.4 ? 5 NA ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NC ? B HEC . ? A HEC 130 ? 1_555 177.6 ? 6 NB ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NC ? B HEC . ? A HEC 130 ? 1_555 89.6 ? 7 NE2 ? A HIS 17 ? A HIS 17 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 ND ? B HEC . ? A HEC 130 ? 1_555 87.3 ? 8 NA ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 ND ? B HEC . ? A HEC 130 ? 1_555 88.5 ? 9 NB ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 ND ? B HEC . ? A HEC 130 ? 1_555 178.7 ? 10 NC ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 ND ? B HEC . ? A HEC 130 ? 1_555 89.1 ? 11 NE2 ? A HIS 17 ? A HIS 17 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 175.4 ? 12 NA ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 92.7 ? 13 NB ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 89.6 ? 14 NC ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 87.4 ? 15 ND ? B HEC . ? A HEC 130 ? 1_555 FE ? B HEC . ? A HEC 130 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 90.7 ? 16 NE2 ? A HIS 20 ? A HIS 20 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NA ? C HEC . ? A HEC 153 ? 1_555 91.1 ? 17 NE2 ? A HIS 20 ? A HIS 20 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NB ? C HEC . ? A HEC 153 ? 1_555 91.7 ? 18 NA ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NB ? C HEC . ? A HEC 153 ? 1_555 89.8 ? 19 NE2 ? A HIS 20 ? A HIS 20 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NC ? C HEC . ? A HEC 153 ? 1_555 89.5 ? 20 NA ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NC ? C HEC . ? A HEC 153 ? 1_555 179.1 ? 21 NB ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NC ? C HEC . ? A HEC 153 ? 1_555 90.8 ? 22 NE2 ? A HIS 20 ? A HIS 20 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 ND ? C HEC . ? A HEC 153 ? 1_555 87.0 ? 23 NA ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 ND ? C HEC . ? A HEC 153 ? 1_555 90.5 ? 24 NB ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 ND ? C HEC . ? A HEC 153 ? 1_555 178.6 ? 25 NC ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 ND ? C HEC . ? A HEC 153 ? 1_555 88.9 ? 26 NE2 ? A HIS 20 ? A HIS 20 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NE2 ? A HIS 53 ? A HIS 53 ? 1_555 177.4 ? 27 NA ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NE2 ? A HIS 53 ? A HIS 53 ? 1_555 90.3 ? 28 NB ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NE2 ? A HIS 53 ? A HIS 53 ? 1_555 90.5 ? 29 NC ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NE2 ? A HIS 53 ? A HIS 53 ? 1_555 89.1 ? 30 ND ? C HEC . ? A HEC 153 ? 1_555 FE ? C HEC . ? A HEC 153 ? 1_555 NE2 ? A HIS 53 ? A HIS 53 ? 1_555 90.8 ? 31 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NA ? D HEC . ? A HEC 166 ? 1_555 91.8 ? 32 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NB ? D HEC . ? A HEC 166 ? 1_555 89.6 ? 33 NA ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NB ? D HEC . ? A HEC 166 ? 1_555 91.3 ? 34 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NC ? D HEC . ? A HEC 166 ? 1_555 91.2 ? 35 NA ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NC ? D HEC . ? A HEC 166 ? 1_555 176.9 ? 36 NB ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NC ? D HEC . ? A HEC 166 ? 1_555 89.0 ? 37 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 ND ? D HEC . ? A HEC 166 ? 1_555 89.1 ? 38 NA ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 ND ? D HEC . ? A HEC 166 ? 1_555 90.2 ? 39 NB ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 ND ? D HEC . ? A HEC 166 ? 1_555 178.1 ? 40 NC ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 ND ? D HEC . ? A HEC 166 ? 1_555 89.6 ? 41 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 177.3 ? 42 NA ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 88.1 ? 43 NB ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 93.0 ? 44 NC ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 88.9 ? 45 ND ? D HEC . ? A HEC 166 ? 1_555 FE ? D HEC . ? A HEC 166 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 88.2 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 HEC B . ? CYS A 26 ? HEC A 130 ? 1_555 CYS A 26 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 2 HEC B . ? CYS A 29 ? HEC A 130 ? 1_555 CYS A 29 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like 3 HEC C . ? CYS A 49 ? HEC A 153 ? 1_555 CYS A 49 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 4 HEC C . ? CYS A 52 ? HEC A 153 ? 1_555 CYS A 52 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like 5 HEC D . ? CYS A 62 ? HEC A 166 ? 1_555 CYS A 62 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 6 HEC D . ? CYS A 65 ? HEC A 166 ? 1_555 CYS A 65 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 3 ? VAL A 4 ? VAL A 3 VAL A 4 A 2 PHE A 15 ? ASP A 16 ? PHE A 15 ASP A 16 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 4 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 4 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 15 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 15 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEC 130 ? 14 'BINDING SITE FOR RESIDUE HEC A 130' AC2 Software A HEC 153 ? 9 'BINDING SITE FOR RESIDUE HEC A 153' AC3 Software A HEC 166 ? 11 'BINDING SITE FOR RESIDUE HEC A 166' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ALA A 1 ? ALA A 1 . ? 1_555 ? 2 AC1 14 TYR A 6 ? TYR A 6 . ? 1_555 ? 3 AC1 14 HIS A 17 ? HIS A 17 . ? 1_555 ? 4 AC1 14 HIS A 20 ? HIS A 20 . ? 1_555 ? 5 AC1 14 ALA A 21 ? ALA A 21 . ? 1_555 ? 6 AC1 14 CYS A 26 ? CYS A 26 . ? 1_555 ? 7 AC1 14 CYS A 29 ? CYS A 29 . ? 1_555 ? 8 AC1 14 HIS A 30 ? HIS A 30 . ? 1_555 ? 9 AC1 14 PRO A 34 ? PRO A 34 . ? 1_555 ? 10 AC1 14 ALA A 35 ? ALA A 35 . ? 1_555 ? 11 AC1 14 LYS A 36 ? LYS A 36 . ? 1_555 ? 12 AC1 14 ILE A 37 ? ILE A 37 . ? 1_555 ? 13 AC1 14 ILE A 39 ? ILE A 39 . ? 1_555 ? 14 AC1 14 HEC C . ? HEC A 153 . ? 1_555 ? 15 AC2 9 VAL A 13 ? VAL A 13 . ? 1_555 ? 16 AC2 9 PHE A 15 ? PHE A 15 . ? 1_555 ? 17 AC2 9 HIS A 20 ? HIS A 20 . ? 1_555 ? 18 AC2 9 LYS A 23 ? LYS A 23 . ? 1_555 ? 19 AC2 9 ALA A 28 ? ALA A 28 . ? 1_555 ? 20 AC2 9 CYS A 49 ? CYS A 49 . ? 1_555 ? 21 AC2 9 CYS A 52 ? CYS A 52 . ? 1_555 ? 22 AC2 9 HIS A 53 ? HIS A 53 . ? 1_555 ? 23 AC2 9 HEC B . ? HEC A 130 . ? 1_555 ? 24 AC3 11 ASN A 8 ? ASN A 8 . ? 1_555 ? 25 AC3 11 ALA A 9 ? ALA A 9 . ? 1_555 ? 26 AC3 11 ALA A 10 ? ALA A 10 . ? 1_555 ? 27 AC3 11 ASP A 40 ? ASP A 40 . ? 1_555 ? 28 AC3 11 LYS A 41 ? LYS A 41 . ? 1_555 ? 29 AC3 11 ALA A 44 ? ALA A 44 . ? 1_555 ? 30 AC3 11 HIS A 45 ? HIS A 45 . ? 1_555 ? 31 AC3 11 CYS A 49 ? CYS A 49 . ? 1_555 ? 32 AC3 11 CYS A 62 ? CYS A 62 . ? 1_555 ? 33 AC3 11 CYS A 65 ? CYS A 65 . ? 1_555 ? 34 AC3 11 HIS A 66 ? HIS A 66 . ? 1_555 ? # _pdbx_entry_details.entry_id 1KWJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -82.30 -133.56 2 1 THR A 14 ? ? 63.53 93.29 3 1 LYS A 18 ? ? -67.02 -75.21 4 1 CYS A 26 ? ? 62.48 -59.51 5 1 GLU A 31 ? ? -66.35 82.01 6 1 ASP A 47 ? ? -148.84 -59.40 7 1 CYS A 49 ? ? 67.60 -62.33 8 1 ASN A 56 ? ? -128.56 -168.67 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id ALA _pdbx_validate_chiral.auth_seq_id 1 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # _pdbx_nmr_ensemble.entry_id 1KWJ _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM cytochrome c7, 100 mM sodium phosphate buffer, pH 6.5' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' # _pdbx_nmr_refine.entry_id 1KWJ _pdbx_nmr_refine.method 'simulated annealing in torsion angle space; restrained energy minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal PSEUDYANA 1.5 'structure solution' 'Guentert, P., Wuethrich, K.' 1 Amber 5.0 refinement 'Kolman, Case' 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 HEC FE FE N N 90 HEC CHA C N N 91 HEC CHB C N N 92 HEC CHC C N N 93 HEC CHD C N N 94 HEC NA N Y N 95 HEC C1A C Y N 96 HEC C2A C Y N 97 HEC C3A C Y N 98 HEC C4A C Y N 99 HEC CMA C N N 100 HEC CAA C N N 101 HEC CBA C N N 102 HEC CGA C N N 103 HEC O1A O N N 104 HEC O2A O N N 105 HEC NB N Y N 106 HEC C1B C Y N 107 HEC C2B C Y N 108 HEC C3B C Y N 109 HEC C4B C Y N 110 HEC CMB C N N 111 HEC CAB C N N 112 HEC CBB C N N 113 HEC NC N Y N 114 HEC C1C C Y N 115 HEC C2C C Y N 116 HEC C3C C Y N 117 HEC C4C C Y N 118 HEC CMC C N N 119 HEC CAC C N N 120 HEC CBC C N N 121 HEC ND N Y N 122 HEC C1D C Y N 123 HEC C2D C Y N 124 HEC C3D C Y N 125 HEC C4D C Y N 126 HEC CMD C N N 127 HEC CAD C N N 128 HEC CBD C N N 129 HEC CGD C N N 130 HEC O1D O N N 131 HEC O2D O N N 132 HEC HHA H N N 133 HEC HHB H N N 134 HEC HHC H N N 135 HEC HHD H N N 136 HEC HMA1 H N N 137 HEC HMA2 H N N 138 HEC HMA3 H N N 139 HEC HAA1 H N N 140 HEC HAA2 H N N 141 HEC HBA1 H N N 142 HEC HBA2 H N N 143 HEC H2A H N N 144 HEC HMB1 H N N 145 HEC HMB2 H N N 146 HEC HMB3 H N N 147 HEC HAB H N N 148 HEC HBB1 H N N 149 HEC HBB2 H N N 150 HEC HBB3 H N N 151 HEC HMC1 H N N 152 HEC HMC2 H N N 153 HEC HMC3 H N N 154 HEC HAC H N N 155 HEC HBC1 H N N 156 HEC HBC2 H N N 157 HEC HBC3 H N N 158 HEC HMD1 H N N 159 HEC HMD2 H N N 160 HEC HMD3 H N N 161 HEC HAD1 H N N 162 HEC HAD2 H N N 163 HEC HBD1 H N N 164 HEC HBD2 H N N 165 HEC H2D H N N 166 HIS N N N N 167 HIS CA C N S 168 HIS C C N N 169 HIS O O N N 170 HIS CB C N N 171 HIS CG C Y N 172 HIS ND1 N Y N 173 HIS CD2 C Y N 174 HIS CE1 C Y N 175 HIS NE2 N Y N 176 HIS OXT O N N 177 HIS H H N N 178 HIS H2 H N N 179 HIS HA H N N 180 HIS HB2 H N N 181 HIS HB3 H N N 182 HIS HD1 H N N 183 HIS HD2 H N N 184 HIS HE1 H N N 185 HIS HE2 H N N 186 HIS HXT H N N 187 ILE N N N N 188 ILE CA C N S 189 ILE C C N N 190 ILE O O N N 191 ILE CB C N S 192 ILE CG1 C N N 193 ILE CG2 C N N 194 ILE CD1 C N N 195 ILE OXT O N N 196 ILE H H N N 197 ILE H2 H N N 198 ILE HA H N N 199 ILE HB H N N 200 ILE HG12 H N N 201 ILE HG13 H N N 202 ILE HG21 H N N 203 ILE HG22 H N N 204 ILE HG23 H N N 205 ILE HD11 H N N 206 ILE HD12 H N N 207 ILE HD13 H N N 208 ILE HXT H N N 209 LEU N N N N 210 LEU CA C N S 211 LEU C C N N 212 LEU O O N N 213 LEU CB C N N 214 LEU CG C N N 215 LEU CD1 C N N 216 LEU CD2 C N N 217 LEU OXT O N N 218 LEU H H N N 219 LEU H2 H N N 220 LEU HA H N N 221 LEU HB2 H N N 222 LEU HB3 H N N 223 LEU HG H N N 224 LEU HD11 H N N 225 LEU HD12 H N N 226 LEU HD13 H N N 227 LEU HD21 H N N 228 LEU HD22 H N N 229 LEU HD23 H N N 230 LEU HXT H N N 231 LYS N N N N 232 LYS CA C N S 233 LYS C C N N 234 LYS O O N N 235 LYS CB C N N 236 LYS CG C N N 237 LYS CD C N N 238 LYS CE C N N 239 LYS NZ N N N 240 LYS OXT O N N 241 LYS H H N N 242 LYS H2 H N N 243 LYS HA H N N 244 LYS HB2 H N N 245 LYS HB3 H N N 246 LYS HG2 H N N 247 LYS HG3 H N N 248 LYS HD2 H N N 249 LYS HD3 H N N 250 LYS HE2 H N N 251 LYS HE3 H N N 252 LYS HZ1 H N N 253 LYS HZ2 H N N 254 LYS HZ3 H N N 255 LYS HXT H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TYR N N N N 328 TYR CA C N S 329 TYR C C N N 330 TYR O O N N 331 TYR CB C N N 332 TYR CG C Y N 333 TYR CD1 C Y N 334 TYR CD2 C Y N 335 TYR CE1 C Y N 336 TYR CE2 C Y N 337 TYR CZ C Y N 338 TYR OH O N N 339 TYR OXT O N N 340 TYR H H N N 341 TYR H2 H N N 342 TYR HA H N N 343 TYR HB2 H N N 344 TYR HB3 H N N 345 TYR HD1 H N N 346 TYR HD2 H N N 347 TYR HE1 H N N 348 TYR HE2 H N N 349 TYR HH H N N 350 TYR HXT H N N 351 VAL N N N N 352 VAL CA C N S 353 VAL C C N N 354 VAL O O N N 355 VAL CB C N N 356 VAL CG1 C N N 357 VAL CG2 C N N 358 VAL OXT O N N 359 VAL H H N N 360 VAL H2 H N N 361 VAL HA H N N 362 VAL HB H N N 363 VAL HG11 H N N 364 VAL HG12 H N N 365 VAL HG13 H N N 366 VAL HG21 H N N 367 VAL HG22 H N N 368 VAL HG23 H N N 369 VAL HXT H N N 370 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLU N CA sing N N 57 GLU N H sing N N 58 GLU N H2 sing N N 59 GLU CA C sing N N 60 GLU CA CB sing N N 61 GLU CA HA sing N N 62 GLU C O doub N N 63 GLU C OXT sing N N 64 GLU CB CG sing N N 65 GLU CB HB2 sing N N 66 GLU CB HB3 sing N N 67 GLU CG CD sing N N 68 GLU CG HG2 sing N N 69 GLU CG HG3 sing N N 70 GLU CD OE1 doub N N 71 GLU CD OE2 sing N N 72 GLU OE2 HE2 sing N N 73 GLU OXT HXT sing N N 74 GLY N CA sing N N 75 GLY N H sing N N 76 GLY N H2 sing N N 77 GLY CA C sing N N 78 GLY CA HA2 sing N N 79 GLY CA HA3 sing N N 80 GLY C O doub N N 81 GLY C OXT sing N N 82 GLY OXT HXT sing N N 83 HEC FE NA sing N N 84 HEC FE NB sing N N 85 HEC FE NC sing N N 86 HEC FE ND sing N N 87 HEC CHA C1A doub N N 88 HEC CHA C4D sing N N 89 HEC CHA HHA sing N N 90 HEC CHB C4A doub N N 91 HEC CHB C1B sing N N 92 HEC CHB HHB sing N N 93 HEC CHC C4B doub N N 94 HEC CHC C1C sing N N 95 HEC CHC HHC sing N N 96 HEC CHD C4C doub N N 97 HEC CHD C1D sing N N 98 HEC CHD HHD sing N N 99 HEC NA C1A sing Y N 100 HEC NA C4A sing Y N 101 HEC C1A C2A sing Y N 102 HEC C2A C3A doub Y N 103 HEC C2A CAA sing N N 104 HEC C3A C4A sing Y N 105 HEC C3A CMA sing N N 106 HEC CMA HMA1 sing N N 107 HEC CMA HMA2 sing N N 108 HEC CMA HMA3 sing N N 109 HEC CAA CBA sing N N 110 HEC CAA HAA1 sing N N 111 HEC CAA HAA2 sing N N 112 HEC CBA CGA sing N N 113 HEC CBA HBA1 sing N N 114 HEC CBA HBA2 sing N N 115 HEC CGA O1A doub N N 116 HEC CGA O2A sing N N 117 HEC O2A H2A sing N N 118 HEC NB C1B sing Y N 119 HEC NB C4B sing Y N 120 HEC C1B C2B doub Y N 121 HEC C2B C3B sing Y N 122 HEC C2B CMB sing N N 123 HEC C3B C4B sing Y N 124 HEC C3B CAB doub N E 125 HEC CMB HMB1 sing N N 126 HEC CMB HMB2 sing N N 127 HEC CMB HMB3 sing N N 128 HEC CAB CBB sing N N 129 HEC CAB HAB sing N N 130 HEC CBB HBB1 sing N N 131 HEC CBB HBB2 sing N N 132 HEC CBB HBB3 sing N N 133 HEC NC C1C sing Y N 134 HEC NC C4C sing Y N 135 HEC C1C C2C doub Y N 136 HEC C2C C3C sing Y N 137 HEC C2C CMC sing N N 138 HEC C3C C4C sing Y N 139 HEC C3C CAC doub N E 140 HEC CMC HMC1 sing N N 141 HEC CMC HMC2 sing N N 142 HEC CMC HMC3 sing N N 143 HEC CAC CBC sing N N 144 HEC CAC HAC sing N N 145 HEC CBC HBC1 sing N N 146 HEC CBC HBC2 sing N N 147 HEC CBC HBC3 sing N N 148 HEC ND C1D sing Y N 149 HEC ND C4D sing Y N 150 HEC C1D C2D doub Y N 151 HEC C2D C3D sing Y N 152 HEC C2D CMD sing N N 153 HEC C3D C4D doub Y N 154 HEC C3D CAD sing N N 155 HEC CMD HMD1 sing N N 156 HEC CMD HMD2 sing N N 157 HEC CMD HMD3 sing N N 158 HEC CAD CBD sing N N 159 HEC CAD HAD1 sing N N 160 HEC CAD HAD2 sing N N 161 HEC CBD CGD sing N N 162 HEC CBD HBD1 sing N N 163 HEC CBD HBD2 sing N N 164 HEC CGD O1D doub N N 165 HEC CGD O2D sing N N 166 HEC O2D H2D sing N N 167 HIS N CA sing N N 168 HIS N H sing N N 169 HIS N H2 sing N N 170 HIS CA C sing N N 171 HIS CA CB sing N N 172 HIS CA HA sing N N 173 HIS C O doub N N 174 HIS C OXT sing N N 175 HIS CB CG sing N N 176 HIS CB HB2 sing N N 177 HIS CB HB3 sing N N 178 HIS CG ND1 sing Y N 179 HIS CG CD2 doub Y N 180 HIS ND1 CE1 doub Y N 181 HIS ND1 HD1 sing N N 182 HIS CD2 NE2 sing Y N 183 HIS CD2 HD2 sing N N 184 HIS CE1 NE2 sing Y N 185 HIS CE1 HE1 sing N N 186 HIS NE2 HE2 sing N N 187 HIS OXT HXT sing N N 188 ILE N CA sing N N 189 ILE N H sing N N 190 ILE N H2 sing N N 191 ILE CA C sing N N 192 ILE CA CB sing N N 193 ILE CA HA sing N N 194 ILE C O doub N N 195 ILE C OXT sing N N 196 ILE CB CG1 sing N N 197 ILE CB CG2 sing N N 198 ILE CB HB sing N N 199 ILE CG1 CD1 sing N N 200 ILE CG1 HG12 sing N N 201 ILE CG1 HG13 sing N N 202 ILE CG2 HG21 sing N N 203 ILE CG2 HG22 sing N N 204 ILE CG2 HG23 sing N N 205 ILE CD1 HD11 sing N N 206 ILE CD1 HD12 sing N N 207 ILE CD1 HD13 sing N N 208 ILE OXT HXT sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TYR N CA sing N N 324 TYR N H sing N N 325 TYR N H2 sing N N 326 TYR CA C sing N N 327 TYR CA CB sing N N 328 TYR CA HA sing N N 329 TYR C O doub N N 330 TYR C OXT sing N N 331 TYR CB CG sing N N 332 TYR CB HB2 sing N N 333 TYR CB HB3 sing N N 334 TYR CG CD1 doub Y N 335 TYR CG CD2 sing Y N 336 TYR CD1 CE1 sing Y N 337 TYR CD1 HD1 sing N N 338 TYR CD2 CE2 doub Y N 339 TYR CD2 HD2 sing N N 340 TYR CE1 CZ doub Y N 341 TYR CE1 HE1 sing N N 342 TYR CE2 CZ sing Y N 343 TYR CE2 HE2 sing N N 344 TYR CZ OH sing N N 345 TYR OH HH sing N N 346 TYR OXT HXT sing N N 347 VAL N CA sing N N 348 VAL N H sing N N 349 VAL N H2 sing N N 350 VAL CA C sing N N 351 VAL CA CB sing N N 352 VAL CA HA sing N N 353 VAL C O doub N N 354 VAL C OXT sing N N 355 VAL CB CG1 sing N N 356 VAL CB CG2 sing N N 357 VAL CB HB sing N N 358 VAL CG1 HG11 sing N N 359 VAL CG1 HG12 sing N N 360 VAL CG1 HG13 sing N N 361 VAL CG2 HG21 sing N N 362 VAL CG2 HG22 sing N N 363 VAL CG2 HG23 sing N N 364 VAL OXT HXT sing N N 365 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1KWJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_