data_1L0H # _entry.id 1L0H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1L0H RCSB RCSB015529 WWPDB D_1000015529 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1L0I _pdbx_database_related.details 'CRYSTAL STRUCTURE OF BUTYRYL-ACP I62M MUTANT' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L0H _pdbx_database_status.recvd_initial_deposition_date 2002-02-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Roujeinikova, A.' 1 'Baldock, C.' 2 'Simon, W.J.' 3 'Gilroy, J.' 4 'Baker, P.J.' 5 'Stuitje, A.R.' 6 'Rice, D.W.' 7 'Slabas, A.R.' 8 'Rafferty, J.B.' 9 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'X-ray crystallographic studies on butyryl-ACP reveal flexibility of the structure around a putative acyl chain binding site' Structure 10 825 835 2002 STRUE6 UK 0969-2126 2005 ? 12057197 '10.1016/S0969-2126(02)00775-X' 1 'Crystallisation and preliminary X-ray crystallographic studies on acyl-(acyl carrier protein) from Escherichia coli' 'Acta Crystallogr.,Sect.D' 58 330 332 2002 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444901020091 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Roujeinikova, A.' 1 primary 'Baldock, C.' 2 primary 'Simon, W.J.' 3 primary 'Gilroy, J.' 4 primary 'Baker, P.J.' 5 primary 'Stuitje, A.R.' 6 primary 'Rice, D.W.' 7 primary 'Slabas, A.R.' 8 primary 'Rafferty, J.B.' 9 1 'Roujeinikova, A.' 10 1 'Baldock, C.' 11 1 'Simon, W.J.' 12 1 'Gilroy, J.' 13 1 'Baker, P.J.' 14 1 'Stuitje, A.R.' 15 1 'Rice, D.W.' 16 1 'Rafferty, J.B.' 17 1 'Slabas, A.R.' 18 # _cell.entry_id 1L0H _cell.length_a 63.360 _cell.length_b 63.360 _cell.length_c 37.049 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1L0H _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ACYL CARRIER PROTEIN' 8645.460 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ACP, CAF, CYTOSOLIC ACTIVATING FACTOR' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA _entity_poly.pdbx_seq_one_letter_code_can MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 THR n 1 4 ILE n 1 5 GLU n 1 6 GLU n 1 7 ARG n 1 8 VAL n 1 9 LYS n 1 10 LYS n 1 11 ILE n 1 12 ILE n 1 13 GLY n 1 14 GLU n 1 15 GLN n 1 16 LEU n 1 17 GLY n 1 18 VAL n 1 19 LYS n 1 20 GLN n 1 21 GLU n 1 22 GLU n 1 23 VAL n 1 24 THR n 1 25 ASN n 1 26 ASN n 1 27 ALA n 1 28 SER n 1 29 PHE n 1 30 VAL n 1 31 GLU n 1 32 ASP n 1 33 LEU n 1 34 GLY n 1 35 ALA n 1 36 ASP n 1 37 SER n 1 38 LEU n 1 39 ASP n 1 40 THR n 1 41 VAL n 1 42 GLU n 1 43 LEU n 1 44 VAL n 1 45 MET n 1 46 ALA n 1 47 LEU n 1 48 GLU n 1 49 GLU n 1 50 GLU n 1 51 PHE n 1 52 ASP n 1 53 THR n 1 54 GLU n 1 55 ILE n 1 56 PRO n 1 57 ASP n 1 58 GLU n 1 59 GLU n 1 60 ALA n 1 61 GLU n 1 62 LYS n 1 63 ILE n 1 64 THR n 1 65 THR n 1 66 VAL n 1 67 GLN n 1 68 ALA n 1 69 ALA n 1 70 ILE n 1 71 ASP n 1 72 TYR n 1 73 ILE n 1 74 ASN n 1 75 GLY n 1 76 HIS n 1 77 GLN n 1 78 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET11D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACP_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA _struct_ref.pdbx_align_begin 0 _struct_ref.pdbx_db_accession P0A6A8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L0H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A6A8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1L0H _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_percent_sol 50.46 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details 'PEG 20000, zinc chloride, sodium cacodylate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM30A' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM30A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97 # _reflns.entry_id 1L0H _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.0 _reflns.number_obs 10616 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.05 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs 0.269 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1L0H _refine.ls_number_reflns_obs 10123 _refine.ls_number_reflns_all 10123 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.205 _refine.ls_R_factor_R_free 0.252 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5 _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 36 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'ACP I62M mutant, PDB ENTRY 1L0I' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 591 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 651 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1L0H _struct.title 'CRYSTAL STRUCTURE OF BUTYRYL-ACP FROM E.COLI' _struct.pdbx_descriptor 'Acyl carrier protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L0H _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' _struct_keywords.text 'acyl carrier protein, acyl chain binding, fatty acid biosynthesis, LIPID TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? GLY A 17 ? THR A 2 GLY A 16 1 ? 15 HELX_P HELX_P2 2 LYS A 19 ? VAL A 23 ? LYS A 18 VAL A 22 5 ? 5 HELX_P HELX_P3 3 ASP A 36 ? PHE A 51 ? ASP A 35 PHE A 50 1 ? 16 HELX_P HELX_P4 4 PRO A 56 ? GLU A 61 ? PRO A 55 GLU A 60 1 ? 6 HELX_P HELX_P5 5 THR A 65 ? HIS A 76 ? THR A 64 HIS A 75 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 5 OE2 ? ? A ZN 80 A GLU 4 1_555 ? ? ? ? ? ? ? 2.159 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 80 A HOH 131 1_555 ? ? ? ? ? ? ? 2.172 ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 81 A HOH 92 1_555 ? ? ? ? ? ? ? 2.079 ? metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 A ASP 32 OD1 ? ? A ZN 81 A ASP 31 1_555 ? ? ? ? ? ? ? 1.960 ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 61 OE2 ? ? A ZN 80 A GLU 60 6_555 ? ? ? ? ? ? ? 1.980 ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 58 OE2 ? ? A ZN 80 A GLU 57 6_555 ? ? ? ? ? ? ? 2.164 ? metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 59 OE2 ? ? A ZN 81 A GLU 58 6_554 ? ? ? ? ? ? ? 2.398 ? metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 76 NE2 ? ? A ZN 81 A HIS 75 6_554 ? ? ? ? ? ? ? 2.318 ? metalc9 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 59 OE1 ? ? A ZN 81 A GLU 58 6_554 ? ? ? ? ? ? ? 2.246 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 80' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 81' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 5 ? GLU A 4 . ? 1_555 ? 2 AC1 4 GLU A 58 ? GLU A 57 . ? 6_555 ? 3 AC1 4 GLU A 61 ? GLU A 60 . ? 6_555 ? 4 AC1 4 HOH D . ? HOH A 131 . ? 1_555 ? 5 AC2 4 ASP A 32 ? ASP A 31 . ? 1_555 ? 6 AC2 4 GLU A 59 ? GLU A 58 . ? 6_554 ? 7 AC2 4 HIS A 76 ? HIS A 75 . ? 6_554 ? 8 AC2 4 HOH D . ? HOH A 92 . ? 1_555 ? # _database_PDB_matrix.entry_id 1L0H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1L0H _atom_sites.fract_transf_matrix[1][1] 0.015783 _atom_sites.fract_transf_matrix[1][2] 0.009112 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018224 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026991 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 ILE 4 3 3 ILE ILE A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 ARG 7 6 6 ARG ARG A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 ILE 11 10 10 ILE ILE A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 GLY 13 12 12 GLY GLY A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 GLY 17 16 16 GLY GLY A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 GLN 20 19 19 GLN GLN A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 THR 24 23 23 THR THR A . n A 1 25 ASN 25 24 24 ASN ASN A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 SER 28 27 27 SER SER A . n A 1 29 PHE 29 28 28 PHE PHE A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 ASP 32 31 31 ASP ASP A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 ALA 35 34 34 ALA ALA A . n A 1 36 ASP 36 35 35 ASP ASP A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 VAL 44 43 43 VAL VAL A . n A 1 45 MET 45 44 44 MET MET A . n A 1 46 ALA 46 45 45 ALA ALA A . n A 1 47 LEU 47 46 46 LEU LEU A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 PHE 51 50 50 PHE PHE A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 THR 53 52 52 THR THR A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 PRO 56 55 55 PRO PRO A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 THR 64 63 63 THR THR A . n A 1 65 THR 65 64 64 THR THR A . n A 1 66 VAL 66 65 65 VAL VAL A . n A 1 67 GLN 67 66 66 GLN GLN A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 ILE 70 69 69 ILE ILE A . n A 1 71 ASP 71 70 70 ASP ASP A . n A 1 72 TYR 72 71 71 TYR TYR A . n A 1 73 ILE 73 72 72 ILE ILE A . n A 1 74 ASN 74 73 73 ASN ASN A . n A 1 75 GLY 75 74 74 GLY GLY A . n A 1 76 HIS 76 75 75 HIS HIS A . n A 1 77 GLN 77 76 76 GLN GLN A . n A 1 78 ALA 78 77 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 5 ? A GLU 4 ? 1_555 ZN ? B ZN . ? A ZN 80 ? 1_555 O ? D HOH . ? A HOH 131 ? 1_555 116.5 ? 2 OE2 ? A GLU 5 ? A GLU 4 ? 1_555 ZN ? B ZN . ? A ZN 80 ? 1_555 OE2 ? A GLU 61 ? A GLU 60 ? 6_555 96.0 ? 3 O ? D HOH . ? A HOH 131 ? 1_555 ZN ? B ZN . ? A ZN 80 ? 1_555 OE2 ? A GLU 61 ? A GLU 60 ? 6_555 106.6 ? 4 OE2 ? A GLU 5 ? A GLU 4 ? 1_555 ZN ? B ZN . ? A ZN 80 ? 1_555 OE2 ? A GLU 58 ? A GLU 57 ? 6_555 144.3 ? 5 O ? D HOH . ? A HOH 131 ? 1_555 ZN ? B ZN . ? A ZN 80 ? 1_555 OE2 ? A GLU 58 ? A GLU 57 ? 6_555 88.2 ? 6 OE2 ? A GLU 61 ? A GLU 60 ? 6_555 ZN ? B ZN . ? A ZN 80 ? 1_555 OE2 ? A GLU 58 ? A GLU 57 ? 6_555 101.3 ? 7 O ? D HOH . ? A HOH 92 ? 1_555 ZN ? C ZN . ? A ZN 81 ? 1_555 OD1 ? A ASP 32 ? A ASP 31 ? 1_555 122.1 ? 8 O ? D HOH . ? A HOH 92 ? 1_555 ZN ? C ZN . ? A ZN 81 ? 1_555 OE2 ? A GLU 59 ? A GLU 58 ? 6_554 85.4 ? 9 OD1 ? A ASP 32 ? A ASP 31 ? 1_555 ZN ? C ZN . ? A ZN 81 ? 1_555 OE2 ? A GLU 59 ? A GLU 58 ? 6_554 131.3 ? 10 O ? D HOH . ? A HOH 92 ? 1_555 ZN ? C ZN . ? A ZN 81 ? 1_555 NE2 ? A HIS 76 ? A HIS 75 ? 6_554 107.5 ? 11 OD1 ? A ASP 32 ? A ASP 31 ? 1_555 ZN ? C ZN . ? A ZN 81 ? 1_555 NE2 ? A HIS 76 ? A HIS 75 ? 6_554 105.8 ? 12 OE2 ? A GLU 59 ? A GLU 58 ? 6_554 ZN ? C ZN . ? A ZN 81 ? 1_555 NE2 ? A HIS 76 ? A HIS 75 ? 6_554 101.7 ? 13 O ? D HOH . ? A HOH 92 ? 1_555 ZN ? C ZN . ? A ZN 81 ? 1_555 OE1 ? A GLU 59 ? A GLU 58 ? 6_554 132.2 ? 14 OD1 ? A ASP 32 ? A ASP 31 ? 1_555 ZN ? C ZN . ? A ZN 81 ? 1_555 OE1 ? A GLU 59 ? A GLU 58 ? 6_554 77.1 ? 15 OE2 ? A GLU 59 ? A GLU 58 ? 6_554 ZN ? C ZN . ? A ZN 81 ? 1_555 OE1 ? A GLU 59 ? A GLU 58 ? 6_554 56.4 ? 16 NE2 ? A HIS 76 ? A HIS 75 ? 6_554 ZN ? C ZN . ? A ZN 81 ? 1_555 OE1 ? A GLU 59 ? A GLU 58 ? 6_554 107.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-02-11 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 CNS refinement . ? 3 CNS phasing . ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 75 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -104.33 _pdbx_validate_torsion.psi 44.99 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A ALA 77 ? A ALA 78 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 80 2 ZN ZN2 A . C 2 ZN 1 81 7 ZN ZN2 A . D 3 HOH 1 82 4 HOH WAT A . D 3 HOH 2 83 5 HOH WAT A . D 3 HOH 3 84 6 HOH WAT A . D 3 HOH 4 85 8 HOH WAT A . D 3 HOH 5 86 9 HOH WAT A . D 3 HOH 6 87 11 HOH WAT A . D 3 HOH 7 88 12 HOH WAT A . D 3 HOH 8 89 13 HOH WAT A . D 3 HOH 9 90 14 HOH WAT A . D 3 HOH 10 91 15 HOH WAT A . D 3 HOH 11 92 16 HOH WAT A . D 3 HOH 12 93 17 HOH WAT A . D 3 HOH 13 94 18 HOH WAT A . D 3 HOH 14 95 19 HOH WAT A . D 3 HOH 15 96 20 HOH WAT A . D 3 HOH 16 97 21 HOH WAT A . D 3 HOH 17 98 22 HOH WAT A . D 3 HOH 18 99 23 HOH WAT A . D 3 HOH 19 100 24 HOH WAT A . D 3 HOH 20 101 25 HOH WAT A . D 3 HOH 21 102 26 HOH WAT A . D 3 HOH 22 103 27 HOH WAT A . D 3 HOH 23 104 28 HOH WAT A . D 3 HOH 24 105 29 HOH WAT A . D 3 HOH 25 106 30 HOH WAT A . D 3 HOH 26 107 31 HOH WAT A . D 3 HOH 27 108 32 HOH WAT A . D 3 HOH 28 109 33 HOH WAT A . D 3 HOH 29 110 34 HOH WAT A . D 3 HOH 30 111 35 HOH WAT A . D 3 HOH 31 112 36 HOH WAT A . D 3 HOH 32 113 37 HOH WAT A . D 3 HOH 33 114 38 HOH WAT A . D 3 HOH 34 115 41 HOH WAT A . D 3 HOH 35 116 42 HOH WAT A . D 3 HOH 36 117 43 HOH WAT A . D 3 HOH 37 118 44 HOH WAT A . D 3 HOH 38 119 46 HOH WAT A . D 3 HOH 39 120 50 HOH WAT A . D 3 HOH 40 121 51 HOH WAT A . D 3 HOH 41 122 52 HOH WAT A . D 3 HOH 42 123 54 HOH WAT A . D 3 HOH 43 124 55 HOH WAT A . D 3 HOH 44 125 56 HOH WAT A . D 3 HOH 45 126 57 HOH WAT A . D 3 HOH 46 127 58 HOH WAT A . D 3 HOH 47 128 59 HOH WAT A . D 3 HOH 48 129 60 HOH WAT A . D 3 HOH 49 130 61 HOH WAT A . D 3 HOH 50 131 62 HOH WAT A . D 3 HOH 51 132 63 HOH WAT A . D 3 HOH 52 133 64 HOH WAT A . D 3 HOH 53 134 65 HOH WAT A . D 3 HOH 54 135 66 HOH WAT A . D 3 HOH 55 136 70 HOH WAT A . D 3 HOH 56 137 71 HOH WAT A . D 3 HOH 57 138 72 HOH WAT A . D 3 HOH 58 139 73 HOH WAT A . #