data_1L2N # _entry.id 1L2N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1L2N pdb_00001l2n 10.2210/pdb1l2n/pdb RCSB RCSB015587 ? ? WWPDB D_1000015587 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L2N _pdbx_database_status.recvd_initial_deposition_date 2002-02-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sheng, W.' 1 'Liao, X.' 2 # _citation.id primary _citation.title ;Solution structure of a yeast ubiquitin-like protein Smt3: the role of structurally less defined sequences in protein-protein recognitions. ; _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 11 _citation.page_first 1482 _citation.page_last 1491 _citation.year 2002 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12021447 _citation.pdbx_database_id_DOI 10.1110/ps.0201602 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sheng, W.' 1 ? primary 'Liao, X.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ubiquitin-like protein SMT3' _entity.formula_weight 11614.036 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPED LDMEDNDIIEAHREQIGGATY ; _entity_poly.pdbx_seq_one_letter_code_can ;MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPED LDMEDNDIIEAHREQIGGATY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASP n 1 4 SER n 1 5 GLU n 1 6 VAL n 1 7 ASN n 1 8 GLN n 1 9 GLU n 1 10 ALA n 1 11 LYS n 1 12 PRO n 1 13 GLU n 1 14 VAL n 1 15 LYS n 1 16 PRO n 1 17 GLU n 1 18 VAL n 1 19 LYS n 1 20 PRO n 1 21 GLU n 1 22 THR n 1 23 HIS n 1 24 ILE n 1 25 ASN n 1 26 LEU n 1 27 LYS n 1 28 VAL n 1 29 SER n 1 30 ASP n 1 31 GLY n 1 32 SER n 1 33 SER n 1 34 GLU n 1 35 ILE n 1 36 PHE n 1 37 PHE n 1 38 LYS n 1 39 ILE n 1 40 LYS n 1 41 LYS n 1 42 THR n 1 43 THR n 1 44 PRO n 1 45 LEU n 1 46 ARG n 1 47 ARG n 1 48 LEU n 1 49 MET n 1 50 GLU n 1 51 ALA n 1 52 PHE n 1 53 ALA n 1 54 LYS n 1 55 ARG n 1 56 GLN n 1 57 GLY n 1 58 LYS n 1 59 GLU n 1 60 MET n 1 61 ASP n 1 62 SER n 1 63 LEU n 1 64 ARG n 1 65 PHE n 1 66 LEU n 1 67 TYR n 1 68 ASP n 1 69 GLY n 1 70 ILE n 1 71 ARG n 1 72 ILE n 1 73 GLN n 1 74 ALA n 1 75 ASP n 1 76 GLN n 1 77 THR n 1 78 PRO n 1 79 GLU n 1 80 ASP n 1 81 LEU n 1 82 ASP n 1 83 MET n 1 84 GLU n 1 85 ASP n 1 86 ASN n 1 87 ASP n 1 88 ILE n 1 89 ILE n 1 90 GLU n 1 91 ALA n 1 92 HIS n 1 93 ARG n 1 94 GLU n 1 95 GLN n 1 96 ILE n 1 97 GLY n 1 98 GLY n 1 99 ALA n 1 100 THR n 1 101 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SMT3_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPED LDMEDNDIIEAHREQIGGATY ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q12306 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L2N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q12306 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 101 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNCA-J 4 1 1 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM C13 and 15N Labelled' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 750 2 ? Bruker DMX 600 3 ? Bruker DRX 600 # _pdbx_nmr_refine.entry_id 1L2N _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1L2N _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1L2N _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1L2N _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized target function' # _pdbx_nmr_software.name DYANA _pdbx_nmr_software.version 1.5 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors 'Gunter, P.' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1L2N _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1L2N _struct.title 'Smt3 Solution Structure' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L2N _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Smt3, Ubiquitin-like Protein, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 43 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 43 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 56 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 35 ? ILE A 39 ? ILE A 35 ILE A 39 A 2 ILE A 24 ? SER A 29 ? ILE A 24 SER A 29 A 3 ASP A 87 ? HIS A 92 ? ASP A 87 HIS A 92 A 4 ARG A 64 ? LEU A 66 ? ARG A 64 LEU A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 37 ? O PHE A 37 N LEU A 26 ? N LEU A 26 A 2 3 N SER A 29 ? N SER A 29 O ALA A 91 ? O ALA A 91 A 3 4 O HIS A 92 ? O HIS A 92 N ARG A 64 ? N ARG A 64 # _database_PDB_matrix.entry_id 1L2N _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1L2N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 GLN 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 PRO 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 LYS 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 GLU 17 17 ? ? ? A . n A 1 18 VAL 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 PRO 20 20 ? ? ? A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLY 97 97 ? ? ? A . n A 1 98 GLY 98 98 ? ? ? A . n A 1 99 ALA 99 99 ? ? ? A . n A 1 100 THR 100 100 ? ? ? A . n A 1 101 TYR 101 101 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-03-06 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLN 56 ? ? H A GLU 59 ? ? 1.57 2 1 O A ALA 51 ? ? H A LYS 54 ? ? 1.58 3 2 HG A SER 62 ? ? O A HIS 92 ? ? 1.53 4 2 O A ALA 51 ? ? H A LYS 54 ? ? 1.59 5 3 O A GLN 56 ? ? H A GLU 59 ? ? 1.54 6 3 O A ALA 51 ? ? H A LYS 54 ? ? 1.57 7 4 HD2 A ASP 75 ? ? O A ASN 86 ? ? 1.51 8 4 O A ALA 51 ? ? H A LYS 54 ? ? 1.57 9 5 O A ALA 51 ? ? H A LYS 54 ? ? 1.54 10 6 HD2 A ASP 30 ? ? O A SER 33 ? ? 1.40 11 6 O A ALA 51 ? ? H A LYS 54 ? ? 1.52 12 7 O A ALA 51 ? ? H A LYS 54 ? ? 1.56 13 8 O A ALA 51 ? ? H A LYS 54 ? ? 1.52 14 8 O A ALA 91 ? ? HD1 A HIS 92 ? ? 1.57 15 8 O A ARG 47 ? ? H A ALA 51 ? ? 1.59 16 9 O A GLN 56 ? ? H A GLU 59 ? ? 1.51 17 9 O A ALA 51 ? ? H A LYS 54 ? ? 1.56 18 9 O A THR 42 ? ? HD2 A ASP 87 ? ? 1.58 19 10 O A ALA 51 ? ? H A LYS 54 ? ? 1.57 20 11 O A ALA 51 ? ? H A LYS 54 ? ? 1.54 21 11 OD1 A ASP 30 ? ? H A SER 33 ? ? 1.56 22 11 O A SER 32 ? ? HE2 A GLU 34 ? ? 1.57 23 12 O A ASP 80 ? ? H A GLU 84 ? ? 1.49 24 12 O A ALA 51 ? ? H A LYS 54 ? ? 1.58 25 13 O A ALA 51 ? ? H A LYS 54 ? ? 1.52 26 13 O A GLN 56 ? ? H A GLU 59 ? ? 1.59 27 14 O A ALA 51 ? ? H A LYS 54 ? ? 1.53 28 15 O A ALA 51 ? ? H A LYS 54 ? ? 1.51 29 16 O A ARG 64 ? ? H A HIS 92 ? ? 1.58 30 16 O A ALA 51 ? ? H A LYS 54 ? ? 1.59 31 16 O A THR 42 ? ? HD2 A ASP 87 ? ? 1.59 32 17 O A ALA 51 ? ? H A LYS 54 ? ? 1.56 33 18 O A ALA 51 ? ? H A LYS 54 ? ? 1.57 34 19 O A ALA 51 ? ? H A LYS 54 ? ? 1.53 35 20 O A ALA 51 ? ? H A LYS 54 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 40 ? ? -90.63 58.13 2 1 LYS A 41 ? ? 177.64 127.75 3 1 THR A 43 ? ? -33.56 94.68 4 1 ARG A 47 ? ? -62.57 -77.92 5 1 ALA A 51 ? ? -41.77 -70.72 6 1 MET A 60 ? ? 37.99 29.79 7 1 ILE A 70 ? ? -156.69 42.34 8 1 MET A 83 ? ? -100.62 -74.26 9 1 ASN A 86 ? ? -175.56 94.65 10 1 GLU A 94 ? ? -161.23 79.81 11 2 GLU A 34 ? ? -49.78 108.08 12 2 LYS A 40 ? ? -106.40 62.85 13 2 LYS A 41 ? ? 178.88 140.65 14 2 THR A 43 ? ? -30.19 91.97 15 2 MET A 60 ? ? 44.48 29.09 16 2 ASP A 68 ? ? -116.08 -75.10 17 2 ILE A 70 ? ? -160.37 30.43 18 2 ALA A 74 ? ? -82.04 -90.44 19 2 ASP A 75 ? ? -103.69 46.71 20 2 MET A 83 ? ? -100.30 -83.78 21 2 ASN A 86 ? ? -177.05 86.57 22 2 GLU A 94 ? ? -160.78 79.12 23 3 LYS A 40 ? ? -101.06 63.96 24 3 LYS A 41 ? ? 179.58 131.11 25 3 THR A 43 ? ? -35.62 94.78 26 3 ALA A 51 ? ? -45.08 -70.04 27 3 MET A 60 ? ? 37.79 29.83 28 3 ASP A 68 ? ? -109.53 -74.61 29 3 ILE A 70 ? ? -158.14 32.91 30 3 ALA A 74 ? ? -80.65 -87.68 31 3 ASP A 75 ? ? -107.89 44.29 32 3 MET A 83 ? ? -100.75 -70.40 33 3 ASN A 86 ? ? -176.33 92.54 34 3 GLU A 94 ? ? -161.01 79.41 35 3 GLN A 95 ? ? -160.33 119.81 36 4 LYS A 40 ? ? -102.05 59.49 37 4 LYS A 41 ? ? 178.62 140.93 38 4 THR A 43 ? ? -30.86 93.08 39 4 ARG A 47 ? ? -55.97 -76.15 40 4 MET A 60 ? ? 36.28 31.58 41 4 ILE A 70 ? ? -159.43 34.84 42 4 ALA A 74 ? ? -84.86 -72.54 43 4 MET A 83 ? ? -98.77 -77.73 44 4 ASN A 86 ? ? -177.83 99.70 45 4 GLU A 94 ? ? -160.34 78.62 46 5 LYS A 40 ? ? -99.25 58.86 47 5 LYS A 41 ? ? 179.42 140.83 48 5 THR A 43 ? ? -32.11 93.07 49 5 MET A 60 ? ? 45.90 29.07 50 5 ASP A 68 ? ? -110.59 -78.43 51 5 ILE A 70 ? ? -148.98 25.44 52 5 ALA A 74 ? ? -82.47 -87.70 53 5 ASP A 75 ? ? -104.11 47.06 54 5 MET A 83 ? ? -100.35 -77.22 55 5 ASN A 86 ? ? -176.92 88.20 56 5 GLU A 94 ? ? -160.60 78.64 57 6 LYS A 40 ? ? -99.54 58.64 58 6 LYS A 41 ? ? 178.41 142.47 59 6 THR A 43 ? ? -27.34 88.45 60 6 MET A 60 ? ? 42.81 29.33 61 6 ILE A 70 ? ? -158.34 44.21 62 6 ARG A 71 ? ? 39.17 51.30 63 6 ALA A 74 ? ? -82.94 -90.58 64 6 ASP A 75 ? ? -96.48 42.74 65 6 MET A 83 ? ? -100.89 -76.93 66 6 ASN A 86 ? ? -176.26 95.74 67 6 GLU A 94 ? ? -157.64 79.23 68 6 GLN A 95 ? ? -160.37 113.11 69 7 LYS A 40 ? ? -102.67 59.03 70 7 LYS A 41 ? ? 178.07 140.66 71 7 THR A 43 ? ? -32.93 94.65 72 7 ARG A 47 ? ? -60.88 -75.16 73 7 MET A 49 ? ? -38.20 -39.71 74 7 MET A 60 ? ? 41.07 27.90 75 7 ASP A 68 ? ? -114.31 -74.36 76 7 ILE A 70 ? ? -152.46 37.91 77 7 ALA A 74 ? ? -82.19 -79.65 78 7 MET A 83 ? ? -94.20 -77.52 79 7 GLU A 84 ? ? -59.71 170.96 80 7 ASN A 86 ? ? -176.85 94.62 81 7 GLU A 94 ? ? -160.54 78.88 82 8 LYS A 41 ? ? 178.32 133.56 83 8 THR A 43 ? ? -30.85 90.46 84 8 ARG A 47 ? ? -55.81 -73.31 85 8 LEU A 63 ? ? -140.38 31.78 86 8 ILE A 70 ? ? -159.17 46.83 87 8 ARG A 71 ? ? 38.10 50.51 88 8 ALA A 74 ? ? -81.89 -99.51 89 8 ASP A 75 ? ? -91.49 45.28 90 8 MET A 83 ? ? -93.50 -82.98 91 8 ASN A 86 ? ? -176.42 89.34 92 8 GLU A 94 ? ? -160.46 85.04 93 9 LYS A 40 ? ? -101.19 59.26 94 9 LYS A 41 ? ? -178.67 129.44 95 9 THR A 43 ? ? -35.80 96.14 96 9 ARG A 47 ? ? -64.13 -77.57 97 9 MET A 60 ? ? 40.83 29.57 98 9 LEU A 63 ? ? -143.83 38.44 99 9 ASP A 68 ? ? -123.95 -73.60 100 9 ILE A 70 ? ? -159.94 37.68 101 9 ALA A 74 ? ? -89.64 -84.31 102 9 MET A 83 ? ? -100.59 -75.93 103 9 ASN A 86 ? ? -176.05 100.84 104 9 GLU A 94 ? ? -160.41 78.68 105 9 GLN A 95 ? ? -160.36 119.64 106 10 LYS A 41 ? ? 178.98 142.53 107 10 THR A 43 ? ? -29.16 90.59 108 10 LEU A 45 ? ? -39.13 -37.72 109 10 MET A 60 ? ? 36.24 31.85 110 10 LEU A 63 ? ? -143.84 38.40 111 10 ASP A 68 ? ? -123.54 -70.83 112 10 ILE A 70 ? ? -165.62 43.65 113 10 ALA A 74 ? ? -81.51 -99.37 114 10 ASP A 75 ? ? -89.31 42.78 115 10 MET A 83 ? ? -100.39 -77.56 116 10 ASN A 86 ? ? -176.44 97.56 117 10 GLU A 94 ? ? -159.70 79.35 118 11 LYS A 40 ? ? -101.60 57.56 119 11 LYS A 41 ? ? 175.96 133.15 120 11 THR A 43 ? ? -34.21 93.64 121 11 ARG A 47 ? ? -73.22 -70.16 122 11 MET A 60 ? ? 44.69 28.24 123 11 ASP A 68 ? ? -110.15 -75.13 124 11 ILE A 70 ? ? -152.82 48.78 125 11 ARG A 71 ? ? 38.90 57.58 126 11 ALA A 74 ? ? -88.74 -88.48 127 11 ASP A 75 ? ? -95.49 40.19 128 11 MET A 83 ? ? -100.40 -81.68 129 11 ASN A 86 ? ? -175.79 95.41 130 11 GLU A 94 ? ? -160.98 78.58 131 11 GLN A 95 ? ? -160.19 117.52 132 12 LYS A 40 ? ? -103.50 59.23 133 12 LYS A 41 ? ? 179.36 143.69 134 12 THR A 43 ? ? -31.40 93.12 135 12 LEU A 45 ? ? -39.33 -37.65 136 12 MET A 60 ? ? 38.38 29.08 137 12 ASP A 68 ? ? -116.84 -71.85 138 12 ILE A 70 ? ? -157.45 40.24 139 12 ALA A 74 ? ? -82.14 -88.69 140 12 ASP A 75 ? ? -102.62 44.76 141 12 ASN A 86 ? ? -177.14 98.34 142 12 GLU A 94 ? ? -161.19 78.88 143 13 LYS A 40 ? ? -94.88 59.22 144 13 LYS A 41 ? ? -179.96 142.72 145 13 THR A 43 ? ? -27.80 90.14 146 13 LEU A 45 ? ? -38.56 -39.44 147 13 MET A 60 ? ? 38.17 29.44 148 13 ASP A 68 ? ? -107.11 -74.25 149 13 ILE A 70 ? ? -153.47 43.55 150 13 ALA A 74 ? ? -84.97 -76.56 151 13 MET A 83 ? ? -100.79 -79.63 152 13 ASN A 86 ? ? -176.96 93.68 153 13 GLU A 94 ? ? -160.51 79.30 154 14 LYS A 40 ? ? -100.69 59.16 155 14 LYS A 41 ? ? 179.17 136.36 156 14 THR A 43 ? ? -30.48 93.23 157 14 ARG A 47 ? ? -62.17 -76.65 158 14 MET A 60 ? ? 42.85 29.22 159 14 LEU A 63 ? ? -145.70 19.87 160 14 ASP A 68 ? ? -122.31 -67.54 161 14 ILE A 70 ? ? -156.70 45.18 162 14 ARG A 71 ? ? 37.83 50.65 163 14 ALA A 74 ? ? -81.88 -89.24 164 14 ASP A 75 ? ? -103.01 45.37 165 14 MET A 83 ? ? -100.42 -76.21 166 14 ASN A 86 ? ? -176.85 95.68 167 14 GLU A 94 ? ? -156.82 78.88 168 15 LYS A 40 ? ? -102.96 58.48 169 15 LYS A 41 ? ? 178.35 133.54 170 15 THR A 43 ? ? -30.42 91.57 171 15 ARG A 47 ? ? -57.04 -75.56 172 15 ARG A 55 ? ? -100.71 -60.73 173 15 MET A 60 ? ? 38.72 29.31 174 15 ASP A 68 ? ? -107.37 -76.94 175 15 ILE A 70 ? ? -150.54 33.88 176 15 ALA A 74 ? ? -82.30 -90.73 177 15 ASP A 75 ? ? -101.28 43.53 178 15 MET A 83 ? ? -100.86 -79.50 179 15 ASN A 86 ? ? -176.74 100.65 180 15 GLU A 94 ? ? -160.82 79.45 181 16 LYS A 40 ? ? -104.15 59.56 182 16 LYS A 41 ? ? 179.26 143.46 183 16 THR A 43 ? ? -33.37 93.96 184 16 ARG A 47 ? ? -60.36 -76.69 185 16 MET A 60 ? ? 45.45 28.37 186 16 ASP A 68 ? ? -123.16 -69.50 187 16 ILE A 70 ? ? -160.17 32.34 188 16 ALA A 74 ? ? -82.74 -89.39 189 16 ASP A 75 ? ? -101.53 41.18 190 16 MET A 83 ? ? -96.56 -75.37 191 16 ASN A 86 ? ? -178.26 95.16 192 16 GLU A 94 ? ? -160.53 79.09 193 17 LYS A 40 ? ? -102.64 59.87 194 17 LYS A 41 ? ? 178.62 141.23 195 17 THR A 43 ? ? -33.85 95.38 196 17 ARG A 47 ? ? -64.03 -78.45 197 17 MET A 60 ? ? 38.40 29.88 198 17 LEU A 63 ? ? -144.94 17.08 199 17 ASP A 68 ? ? -135.51 -72.72 200 17 ILE A 70 ? ? -165.96 43.38 201 17 ARG A 71 ? ? 38.73 52.01 202 17 ALA A 74 ? ? -80.50 -97.90 203 17 ASP A 75 ? ? -96.17 42.95 204 17 MET A 83 ? ? -101.03 -75.24 205 17 ASN A 86 ? ? -176.88 101.82 206 17 GLU A 94 ? ? -158.45 79.57 207 18 GLU A 34 ? ? -36.83 108.20 208 18 LYS A 40 ? ? -101.26 61.97 209 18 LYS A 41 ? ? 179.16 138.98 210 18 THR A 43 ? ? -31.71 92.61 211 18 MET A 60 ? ? 39.65 29.08 212 18 ASP A 68 ? ? -124.91 -68.43 213 18 ILE A 70 ? ? -156.01 48.10 214 18 ARG A 71 ? ? 38.07 49.35 215 18 ALA A 74 ? ? -95.21 -99.63 216 18 ASP A 75 ? ? -86.63 45.14 217 18 MET A 83 ? ? -95.73 -82.98 218 18 ASN A 86 ? ? -176.91 89.64 219 18 GLU A 94 ? ? -156.63 79.07 220 19 LYS A 40 ? ? -101.27 59.19 221 19 LYS A 41 ? ? -175.25 128.10 222 19 THR A 43 ? ? -33.21 97.07 223 19 ARG A 47 ? ? -55.75 -80.87 224 19 MET A 60 ? ? 46.99 29.44 225 19 LEU A 63 ? ? -144.74 39.94 226 19 ASP A 68 ? ? -110.18 -75.53 227 19 ILE A 70 ? ? -152.28 48.35 228 19 ARG A 71 ? ? 39.03 58.59 229 19 ALA A 74 ? ? -80.37 -91.40 230 19 ASP A 75 ? ? -83.64 47.98 231 19 MET A 83 ? ? -100.51 -78.94 232 19 ASN A 86 ? ? -174.59 95.62 233 19 GLU A 94 ? ? -160.09 79.14 234 20 LYS A 40 ? ? -98.67 59.74 235 20 LYS A 41 ? ? 179.34 135.39 236 20 THR A 43 ? ? -36.23 98.92 237 20 ARG A 47 ? ? -62.69 -77.74 238 20 ARG A 55 ? ? -101.14 -61.11 239 20 MET A 60 ? ? 42.60 29.10 240 20 LEU A 63 ? ? -140.80 14.37 241 20 ILE A 70 ? ? -153.58 49.70 242 20 ARG A 71 ? ? 36.69 44.36 243 20 ALA A 74 ? ? -82.71 -80.04 244 20 MET A 83 ? ? -98.29 -83.69 245 20 ASN A 86 ? ? -178.25 100.54 246 20 GLU A 94 ? ? -161.08 78.91 247 20 GLN A 95 ? ? -156.22 79.61 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A GLN 8 ? A GLN 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A PRO 12 ? A PRO 12 13 1 Y 1 A GLU 13 ? A GLU 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A LYS 15 ? A LYS 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A GLU 17 ? A GLU 17 18 1 Y 1 A VAL 18 ? A VAL 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A PRO 20 ? A PRO 20 21 1 Y 1 A GLY 97 ? A GLY 97 22 1 Y 1 A GLY 98 ? A GLY 98 23 1 Y 1 A ALA 99 ? A ALA 99 24 1 Y 1 A THR 100 ? A THR 100 25 1 Y 1 A TYR 101 ? A TYR 101 26 2 Y 1 A MET 1 ? A MET 1 27 2 Y 1 A SER 2 ? A SER 2 28 2 Y 1 A ASP 3 ? A ASP 3 29 2 Y 1 A SER 4 ? A SER 4 30 2 Y 1 A GLU 5 ? A GLU 5 31 2 Y 1 A VAL 6 ? A VAL 6 32 2 Y 1 A ASN 7 ? A ASN 7 33 2 Y 1 A GLN 8 ? A GLN 8 34 2 Y 1 A GLU 9 ? A GLU 9 35 2 Y 1 A ALA 10 ? A ALA 10 36 2 Y 1 A LYS 11 ? A LYS 11 37 2 Y 1 A PRO 12 ? A PRO 12 38 2 Y 1 A GLU 13 ? A GLU 13 39 2 Y 1 A VAL 14 ? A VAL 14 40 2 Y 1 A LYS 15 ? A LYS 15 41 2 Y 1 A PRO 16 ? A PRO 16 42 2 Y 1 A GLU 17 ? A GLU 17 43 2 Y 1 A VAL 18 ? A VAL 18 44 2 Y 1 A LYS 19 ? A LYS 19 45 2 Y 1 A PRO 20 ? A PRO 20 46 2 Y 1 A GLY 97 ? A GLY 97 47 2 Y 1 A GLY 98 ? A GLY 98 48 2 Y 1 A ALA 99 ? A ALA 99 49 2 Y 1 A THR 100 ? A THR 100 50 2 Y 1 A TYR 101 ? A TYR 101 51 3 Y 1 A MET 1 ? A MET 1 52 3 Y 1 A SER 2 ? A SER 2 53 3 Y 1 A ASP 3 ? A ASP 3 54 3 Y 1 A SER 4 ? A SER 4 55 3 Y 1 A GLU 5 ? A GLU 5 56 3 Y 1 A VAL 6 ? A VAL 6 57 3 Y 1 A ASN 7 ? A ASN 7 58 3 Y 1 A GLN 8 ? A GLN 8 59 3 Y 1 A GLU 9 ? A GLU 9 60 3 Y 1 A ALA 10 ? A ALA 10 61 3 Y 1 A LYS 11 ? A LYS 11 62 3 Y 1 A PRO 12 ? A PRO 12 63 3 Y 1 A GLU 13 ? A GLU 13 64 3 Y 1 A VAL 14 ? A VAL 14 65 3 Y 1 A LYS 15 ? A LYS 15 66 3 Y 1 A PRO 16 ? A PRO 16 67 3 Y 1 A GLU 17 ? A GLU 17 68 3 Y 1 A VAL 18 ? A VAL 18 69 3 Y 1 A LYS 19 ? A LYS 19 70 3 Y 1 A PRO 20 ? A PRO 20 71 3 Y 1 A GLY 97 ? A GLY 97 72 3 Y 1 A GLY 98 ? A GLY 98 73 3 Y 1 A ALA 99 ? A ALA 99 74 3 Y 1 A THR 100 ? A THR 100 75 3 Y 1 A TYR 101 ? A TYR 101 76 4 Y 1 A MET 1 ? A MET 1 77 4 Y 1 A SER 2 ? A SER 2 78 4 Y 1 A ASP 3 ? A ASP 3 79 4 Y 1 A SER 4 ? A SER 4 80 4 Y 1 A GLU 5 ? A GLU 5 81 4 Y 1 A VAL 6 ? A VAL 6 82 4 Y 1 A ASN 7 ? A ASN 7 83 4 Y 1 A GLN 8 ? A GLN 8 84 4 Y 1 A GLU 9 ? A GLU 9 85 4 Y 1 A ALA 10 ? A ALA 10 86 4 Y 1 A LYS 11 ? A LYS 11 87 4 Y 1 A PRO 12 ? A PRO 12 88 4 Y 1 A GLU 13 ? A GLU 13 89 4 Y 1 A VAL 14 ? A VAL 14 90 4 Y 1 A LYS 15 ? A LYS 15 91 4 Y 1 A PRO 16 ? A PRO 16 92 4 Y 1 A GLU 17 ? A GLU 17 93 4 Y 1 A VAL 18 ? A VAL 18 94 4 Y 1 A LYS 19 ? A LYS 19 95 4 Y 1 A PRO 20 ? A PRO 20 96 4 Y 1 A GLY 97 ? A GLY 97 97 4 Y 1 A GLY 98 ? A GLY 98 98 4 Y 1 A ALA 99 ? A ALA 99 99 4 Y 1 A THR 100 ? A THR 100 100 4 Y 1 A TYR 101 ? A TYR 101 101 5 Y 1 A MET 1 ? A MET 1 102 5 Y 1 A SER 2 ? A SER 2 103 5 Y 1 A ASP 3 ? A ASP 3 104 5 Y 1 A SER 4 ? A SER 4 105 5 Y 1 A GLU 5 ? A GLU 5 106 5 Y 1 A VAL 6 ? A VAL 6 107 5 Y 1 A ASN 7 ? A ASN 7 108 5 Y 1 A GLN 8 ? A GLN 8 109 5 Y 1 A GLU 9 ? A GLU 9 110 5 Y 1 A ALA 10 ? A ALA 10 111 5 Y 1 A LYS 11 ? A LYS 11 112 5 Y 1 A PRO 12 ? A PRO 12 113 5 Y 1 A GLU 13 ? A GLU 13 114 5 Y 1 A VAL 14 ? A VAL 14 115 5 Y 1 A LYS 15 ? A LYS 15 116 5 Y 1 A PRO 16 ? A PRO 16 117 5 Y 1 A GLU 17 ? A GLU 17 118 5 Y 1 A VAL 18 ? A VAL 18 119 5 Y 1 A LYS 19 ? A LYS 19 120 5 Y 1 A PRO 20 ? A PRO 20 121 5 Y 1 A GLY 97 ? A GLY 97 122 5 Y 1 A GLY 98 ? A GLY 98 123 5 Y 1 A ALA 99 ? A ALA 99 124 5 Y 1 A THR 100 ? A THR 100 125 5 Y 1 A TYR 101 ? A TYR 101 126 6 Y 1 A MET 1 ? A MET 1 127 6 Y 1 A SER 2 ? A SER 2 128 6 Y 1 A ASP 3 ? A ASP 3 129 6 Y 1 A SER 4 ? A SER 4 130 6 Y 1 A GLU 5 ? A GLU 5 131 6 Y 1 A VAL 6 ? A VAL 6 132 6 Y 1 A ASN 7 ? A ASN 7 133 6 Y 1 A GLN 8 ? A GLN 8 134 6 Y 1 A GLU 9 ? A GLU 9 135 6 Y 1 A ALA 10 ? A ALA 10 136 6 Y 1 A LYS 11 ? A LYS 11 137 6 Y 1 A PRO 12 ? A PRO 12 138 6 Y 1 A GLU 13 ? A GLU 13 139 6 Y 1 A VAL 14 ? A VAL 14 140 6 Y 1 A LYS 15 ? A LYS 15 141 6 Y 1 A PRO 16 ? A PRO 16 142 6 Y 1 A GLU 17 ? A GLU 17 143 6 Y 1 A VAL 18 ? A VAL 18 144 6 Y 1 A LYS 19 ? A LYS 19 145 6 Y 1 A PRO 20 ? A PRO 20 146 6 Y 1 A GLY 97 ? A GLY 97 147 6 Y 1 A GLY 98 ? A GLY 98 148 6 Y 1 A ALA 99 ? A ALA 99 149 6 Y 1 A THR 100 ? A THR 100 150 6 Y 1 A TYR 101 ? A TYR 101 151 7 Y 1 A MET 1 ? A MET 1 152 7 Y 1 A SER 2 ? A SER 2 153 7 Y 1 A ASP 3 ? A ASP 3 154 7 Y 1 A SER 4 ? A SER 4 155 7 Y 1 A GLU 5 ? A GLU 5 156 7 Y 1 A VAL 6 ? A VAL 6 157 7 Y 1 A ASN 7 ? A ASN 7 158 7 Y 1 A GLN 8 ? A GLN 8 159 7 Y 1 A GLU 9 ? A GLU 9 160 7 Y 1 A ALA 10 ? A ALA 10 161 7 Y 1 A LYS 11 ? A LYS 11 162 7 Y 1 A PRO 12 ? A PRO 12 163 7 Y 1 A GLU 13 ? A GLU 13 164 7 Y 1 A VAL 14 ? A VAL 14 165 7 Y 1 A LYS 15 ? A LYS 15 166 7 Y 1 A PRO 16 ? A PRO 16 167 7 Y 1 A GLU 17 ? A GLU 17 168 7 Y 1 A VAL 18 ? A VAL 18 169 7 Y 1 A LYS 19 ? A LYS 19 170 7 Y 1 A PRO 20 ? A PRO 20 171 7 Y 1 A GLY 97 ? A GLY 97 172 7 Y 1 A GLY 98 ? A GLY 98 173 7 Y 1 A ALA 99 ? A ALA 99 174 7 Y 1 A THR 100 ? A THR 100 175 7 Y 1 A TYR 101 ? A TYR 101 176 8 Y 1 A MET 1 ? A MET 1 177 8 Y 1 A SER 2 ? A SER 2 178 8 Y 1 A ASP 3 ? A ASP 3 179 8 Y 1 A SER 4 ? A SER 4 180 8 Y 1 A GLU 5 ? A GLU 5 181 8 Y 1 A VAL 6 ? A VAL 6 182 8 Y 1 A ASN 7 ? A ASN 7 183 8 Y 1 A GLN 8 ? A GLN 8 184 8 Y 1 A GLU 9 ? A GLU 9 185 8 Y 1 A ALA 10 ? A ALA 10 186 8 Y 1 A LYS 11 ? A LYS 11 187 8 Y 1 A PRO 12 ? A PRO 12 188 8 Y 1 A GLU 13 ? A GLU 13 189 8 Y 1 A VAL 14 ? A VAL 14 190 8 Y 1 A LYS 15 ? A LYS 15 191 8 Y 1 A PRO 16 ? A PRO 16 192 8 Y 1 A GLU 17 ? A GLU 17 193 8 Y 1 A VAL 18 ? A VAL 18 194 8 Y 1 A LYS 19 ? A LYS 19 195 8 Y 1 A PRO 20 ? A PRO 20 196 8 Y 1 A GLY 97 ? A GLY 97 197 8 Y 1 A GLY 98 ? A GLY 98 198 8 Y 1 A ALA 99 ? A ALA 99 199 8 Y 1 A THR 100 ? A THR 100 200 8 Y 1 A TYR 101 ? A TYR 101 201 9 Y 1 A MET 1 ? A MET 1 202 9 Y 1 A SER 2 ? A SER 2 203 9 Y 1 A ASP 3 ? A ASP 3 204 9 Y 1 A SER 4 ? A SER 4 205 9 Y 1 A GLU 5 ? A GLU 5 206 9 Y 1 A VAL 6 ? A VAL 6 207 9 Y 1 A ASN 7 ? A ASN 7 208 9 Y 1 A GLN 8 ? A GLN 8 209 9 Y 1 A GLU 9 ? A GLU 9 210 9 Y 1 A ALA 10 ? A ALA 10 211 9 Y 1 A LYS 11 ? A LYS 11 212 9 Y 1 A PRO 12 ? A PRO 12 213 9 Y 1 A GLU 13 ? A GLU 13 214 9 Y 1 A VAL 14 ? A VAL 14 215 9 Y 1 A LYS 15 ? A LYS 15 216 9 Y 1 A PRO 16 ? A PRO 16 217 9 Y 1 A GLU 17 ? A GLU 17 218 9 Y 1 A VAL 18 ? A VAL 18 219 9 Y 1 A LYS 19 ? A LYS 19 220 9 Y 1 A PRO 20 ? A PRO 20 221 9 Y 1 A GLY 97 ? A GLY 97 222 9 Y 1 A GLY 98 ? A GLY 98 223 9 Y 1 A ALA 99 ? A ALA 99 224 9 Y 1 A THR 100 ? A THR 100 225 9 Y 1 A TYR 101 ? A TYR 101 226 10 Y 1 A MET 1 ? A MET 1 227 10 Y 1 A SER 2 ? A SER 2 228 10 Y 1 A ASP 3 ? A ASP 3 229 10 Y 1 A SER 4 ? A SER 4 230 10 Y 1 A GLU 5 ? A GLU 5 231 10 Y 1 A VAL 6 ? A VAL 6 232 10 Y 1 A ASN 7 ? A ASN 7 233 10 Y 1 A GLN 8 ? A GLN 8 234 10 Y 1 A GLU 9 ? A GLU 9 235 10 Y 1 A ALA 10 ? A ALA 10 236 10 Y 1 A LYS 11 ? A LYS 11 237 10 Y 1 A PRO 12 ? A PRO 12 238 10 Y 1 A GLU 13 ? A GLU 13 239 10 Y 1 A VAL 14 ? A VAL 14 240 10 Y 1 A LYS 15 ? A LYS 15 241 10 Y 1 A PRO 16 ? A PRO 16 242 10 Y 1 A GLU 17 ? A GLU 17 243 10 Y 1 A VAL 18 ? A VAL 18 244 10 Y 1 A LYS 19 ? A LYS 19 245 10 Y 1 A PRO 20 ? A PRO 20 246 10 Y 1 A GLY 97 ? A GLY 97 247 10 Y 1 A GLY 98 ? A GLY 98 248 10 Y 1 A ALA 99 ? A ALA 99 249 10 Y 1 A THR 100 ? A THR 100 250 10 Y 1 A TYR 101 ? A TYR 101 251 11 Y 1 A MET 1 ? A MET 1 252 11 Y 1 A SER 2 ? A SER 2 253 11 Y 1 A ASP 3 ? A ASP 3 254 11 Y 1 A SER 4 ? A SER 4 255 11 Y 1 A GLU 5 ? A GLU 5 256 11 Y 1 A VAL 6 ? A VAL 6 257 11 Y 1 A ASN 7 ? A ASN 7 258 11 Y 1 A GLN 8 ? A GLN 8 259 11 Y 1 A GLU 9 ? A GLU 9 260 11 Y 1 A ALA 10 ? A ALA 10 261 11 Y 1 A LYS 11 ? A LYS 11 262 11 Y 1 A PRO 12 ? A PRO 12 263 11 Y 1 A GLU 13 ? A GLU 13 264 11 Y 1 A VAL 14 ? A VAL 14 265 11 Y 1 A LYS 15 ? A LYS 15 266 11 Y 1 A PRO 16 ? A PRO 16 267 11 Y 1 A GLU 17 ? A GLU 17 268 11 Y 1 A VAL 18 ? A VAL 18 269 11 Y 1 A LYS 19 ? A LYS 19 270 11 Y 1 A PRO 20 ? A PRO 20 271 11 Y 1 A GLY 97 ? A GLY 97 272 11 Y 1 A GLY 98 ? A GLY 98 273 11 Y 1 A ALA 99 ? A ALA 99 274 11 Y 1 A THR 100 ? A THR 100 275 11 Y 1 A TYR 101 ? A TYR 101 276 12 Y 1 A MET 1 ? A MET 1 277 12 Y 1 A SER 2 ? A SER 2 278 12 Y 1 A ASP 3 ? A ASP 3 279 12 Y 1 A SER 4 ? A SER 4 280 12 Y 1 A GLU 5 ? A GLU 5 281 12 Y 1 A VAL 6 ? A VAL 6 282 12 Y 1 A ASN 7 ? A ASN 7 283 12 Y 1 A GLN 8 ? A GLN 8 284 12 Y 1 A GLU 9 ? A GLU 9 285 12 Y 1 A ALA 10 ? A ALA 10 286 12 Y 1 A LYS 11 ? A LYS 11 287 12 Y 1 A PRO 12 ? A PRO 12 288 12 Y 1 A GLU 13 ? A GLU 13 289 12 Y 1 A VAL 14 ? A VAL 14 290 12 Y 1 A LYS 15 ? A LYS 15 291 12 Y 1 A PRO 16 ? A PRO 16 292 12 Y 1 A GLU 17 ? A GLU 17 293 12 Y 1 A VAL 18 ? A VAL 18 294 12 Y 1 A LYS 19 ? A LYS 19 295 12 Y 1 A PRO 20 ? A PRO 20 296 12 Y 1 A GLY 97 ? A GLY 97 297 12 Y 1 A GLY 98 ? A GLY 98 298 12 Y 1 A ALA 99 ? A ALA 99 299 12 Y 1 A THR 100 ? A THR 100 300 12 Y 1 A TYR 101 ? A TYR 101 301 13 Y 1 A MET 1 ? A MET 1 302 13 Y 1 A SER 2 ? A SER 2 303 13 Y 1 A ASP 3 ? A ASP 3 304 13 Y 1 A SER 4 ? A SER 4 305 13 Y 1 A GLU 5 ? A GLU 5 306 13 Y 1 A VAL 6 ? A VAL 6 307 13 Y 1 A ASN 7 ? A ASN 7 308 13 Y 1 A GLN 8 ? A GLN 8 309 13 Y 1 A GLU 9 ? A GLU 9 310 13 Y 1 A ALA 10 ? A ALA 10 311 13 Y 1 A LYS 11 ? A LYS 11 312 13 Y 1 A PRO 12 ? A PRO 12 313 13 Y 1 A GLU 13 ? A GLU 13 314 13 Y 1 A VAL 14 ? A VAL 14 315 13 Y 1 A LYS 15 ? A LYS 15 316 13 Y 1 A PRO 16 ? A PRO 16 317 13 Y 1 A GLU 17 ? A GLU 17 318 13 Y 1 A VAL 18 ? A VAL 18 319 13 Y 1 A LYS 19 ? A LYS 19 320 13 Y 1 A PRO 20 ? A PRO 20 321 13 Y 1 A GLY 97 ? A GLY 97 322 13 Y 1 A GLY 98 ? A GLY 98 323 13 Y 1 A ALA 99 ? A ALA 99 324 13 Y 1 A THR 100 ? A THR 100 325 13 Y 1 A TYR 101 ? A TYR 101 326 14 Y 1 A MET 1 ? A MET 1 327 14 Y 1 A SER 2 ? A SER 2 328 14 Y 1 A ASP 3 ? A ASP 3 329 14 Y 1 A SER 4 ? A SER 4 330 14 Y 1 A GLU 5 ? A GLU 5 331 14 Y 1 A VAL 6 ? A VAL 6 332 14 Y 1 A ASN 7 ? A ASN 7 333 14 Y 1 A GLN 8 ? A GLN 8 334 14 Y 1 A GLU 9 ? A GLU 9 335 14 Y 1 A ALA 10 ? A ALA 10 336 14 Y 1 A LYS 11 ? A LYS 11 337 14 Y 1 A PRO 12 ? A PRO 12 338 14 Y 1 A GLU 13 ? A GLU 13 339 14 Y 1 A VAL 14 ? A VAL 14 340 14 Y 1 A LYS 15 ? A LYS 15 341 14 Y 1 A PRO 16 ? A PRO 16 342 14 Y 1 A GLU 17 ? A GLU 17 343 14 Y 1 A VAL 18 ? A VAL 18 344 14 Y 1 A LYS 19 ? A LYS 19 345 14 Y 1 A PRO 20 ? A PRO 20 346 14 Y 1 A GLY 97 ? A GLY 97 347 14 Y 1 A GLY 98 ? A GLY 98 348 14 Y 1 A ALA 99 ? A ALA 99 349 14 Y 1 A THR 100 ? A THR 100 350 14 Y 1 A TYR 101 ? A TYR 101 351 15 Y 1 A MET 1 ? A MET 1 352 15 Y 1 A SER 2 ? A SER 2 353 15 Y 1 A ASP 3 ? A ASP 3 354 15 Y 1 A SER 4 ? A SER 4 355 15 Y 1 A GLU 5 ? A GLU 5 356 15 Y 1 A VAL 6 ? A VAL 6 357 15 Y 1 A ASN 7 ? A ASN 7 358 15 Y 1 A GLN 8 ? A GLN 8 359 15 Y 1 A GLU 9 ? A GLU 9 360 15 Y 1 A ALA 10 ? A ALA 10 361 15 Y 1 A LYS 11 ? A LYS 11 362 15 Y 1 A PRO 12 ? A PRO 12 363 15 Y 1 A GLU 13 ? A GLU 13 364 15 Y 1 A VAL 14 ? A VAL 14 365 15 Y 1 A LYS 15 ? A LYS 15 366 15 Y 1 A PRO 16 ? A PRO 16 367 15 Y 1 A GLU 17 ? A GLU 17 368 15 Y 1 A VAL 18 ? A VAL 18 369 15 Y 1 A LYS 19 ? A LYS 19 370 15 Y 1 A PRO 20 ? A PRO 20 371 15 Y 1 A GLY 97 ? A GLY 97 372 15 Y 1 A GLY 98 ? A GLY 98 373 15 Y 1 A ALA 99 ? A ALA 99 374 15 Y 1 A THR 100 ? A THR 100 375 15 Y 1 A TYR 101 ? A TYR 101 376 16 Y 1 A MET 1 ? A MET 1 377 16 Y 1 A SER 2 ? A SER 2 378 16 Y 1 A ASP 3 ? A ASP 3 379 16 Y 1 A SER 4 ? A SER 4 380 16 Y 1 A GLU 5 ? A GLU 5 381 16 Y 1 A VAL 6 ? A VAL 6 382 16 Y 1 A ASN 7 ? A ASN 7 383 16 Y 1 A GLN 8 ? A GLN 8 384 16 Y 1 A GLU 9 ? A GLU 9 385 16 Y 1 A ALA 10 ? A ALA 10 386 16 Y 1 A LYS 11 ? A LYS 11 387 16 Y 1 A PRO 12 ? A PRO 12 388 16 Y 1 A GLU 13 ? A GLU 13 389 16 Y 1 A VAL 14 ? A VAL 14 390 16 Y 1 A LYS 15 ? A LYS 15 391 16 Y 1 A PRO 16 ? A PRO 16 392 16 Y 1 A GLU 17 ? A GLU 17 393 16 Y 1 A VAL 18 ? A VAL 18 394 16 Y 1 A LYS 19 ? A LYS 19 395 16 Y 1 A PRO 20 ? A PRO 20 396 16 Y 1 A GLY 97 ? A GLY 97 397 16 Y 1 A GLY 98 ? A GLY 98 398 16 Y 1 A ALA 99 ? A ALA 99 399 16 Y 1 A THR 100 ? A THR 100 400 16 Y 1 A TYR 101 ? A TYR 101 401 17 Y 1 A MET 1 ? A MET 1 402 17 Y 1 A SER 2 ? A SER 2 403 17 Y 1 A ASP 3 ? A ASP 3 404 17 Y 1 A SER 4 ? A SER 4 405 17 Y 1 A GLU 5 ? A GLU 5 406 17 Y 1 A VAL 6 ? A VAL 6 407 17 Y 1 A ASN 7 ? A ASN 7 408 17 Y 1 A GLN 8 ? A GLN 8 409 17 Y 1 A GLU 9 ? A GLU 9 410 17 Y 1 A ALA 10 ? A ALA 10 411 17 Y 1 A LYS 11 ? A LYS 11 412 17 Y 1 A PRO 12 ? A PRO 12 413 17 Y 1 A GLU 13 ? A GLU 13 414 17 Y 1 A VAL 14 ? A VAL 14 415 17 Y 1 A LYS 15 ? A LYS 15 416 17 Y 1 A PRO 16 ? A PRO 16 417 17 Y 1 A GLU 17 ? A GLU 17 418 17 Y 1 A VAL 18 ? A VAL 18 419 17 Y 1 A LYS 19 ? A LYS 19 420 17 Y 1 A PRO 20 ? A PRO 20 421 17 Y 1 A GLY 97 ? A GLY 97 422 17 Y 1 A GLY 98 ? A GLY 98 423 17 Y 1 A ALA 99 ? A ALA 99 424 17 Y 1 A THR 100 ? A THR 100 425 17 Y 1 A TYR 101 ? A TYR 101 426 18 Y 1 A MET 1 ? A MET 1 427 18 Y 1 A SER 2 ? A SER 2 428 18 Y 1 A ASP 3 ? A ASP 3 429 18 Y 1 A SER 4 ? A SER 4 430 18 Y 1 A GLU 5 ? A GLU 5 431 18 Y 1 A VAL 6 ? A VAL 6 432 18 Y 1 A ASN 7 ? A ASN 7 433 18 Y 1 A GLN 8 ? A GLN 8 434 18 Y 1 A GLU 9 ? A GLU 9 435 18 Y 1 A ALA 10 ? A ALA 10 436 18 Y 1 A LYS 11 ? A LYS 11 437 18 Y 1 A PRO 12 ? A PRO 12 438 18 Y 1 A GLU 13 ? A GLU 13 439 18 Y 1 A VAL 14 ? A VAL 14 440 18 Y 1 A LYS 15 ? A LYS 15 441 18 Y 1 A PRO 16 ? A PRO 16 442 18 Y 1 A GLU 17 ? A GLU 17 443 18 Y 1 A VAL 18 ? A VAL 18 444 18 Y 1 A LYS 19 ? A LYS 19 445 18 Y 1 A PRO 20 ? A PRO 20 446 18 Y 1 A GLY 97 ? A GLY 97 447 18 Y 1 A GLY 98 ? A GLY 98 448 18 Y 1 A ALA 99 ? A ALA 99 449 18 Y 1 A THR 100 ? A THR 100 450 18 Y 1 A TYR 101 ? A TYR 101 451 19 Y 1 A MET 1 ? A MET 1 452 19 Y 1 A SER 2 ? A SER 2 453 19 Y 1 A ASP 3 ? A ASP 3 454 19 Y 1 A SER 4 ? A SER 4 455 19 Y 1 A GLU 5 ? A GLU 5 456 19 Y 1 A VAL 6 ? A VAL 6 457 19 Y 1 A ASN 7 ? A ASN 7 458 19 Y 1 A GLN 8 ? A GLN 8 459 19 Y 1 A GLU 9 ? A GLU 9 460 19 Y 1 A ALA 10 ? A ALA 10 461 19 Y 1 A LYS 11 ? A LYS 11 462 19 Y 1 A PRO 12 ? A PRO 12 463 19 Y 1 A GLU 13 ? A GLU 13 464 19 Y 1 A VAL 14 ? A VAL 14 465 19 Y 1 A LYS 15 ? A LYS 15 466 19 Y 1 A PRO 16 ? A PRO 16 467 19 Y 1 A GLU 17 ? A GLU 17 468 19 Y 1 A VAL 18 ? A VAL 18 469 19 Y 1 A LYS 19 ? A LYS 19 470 19 Y 1 A PRO 20 ? A PRO 20 471 19 Y 1 A GLY 97 ? A GLY 97 472 19 Y 1 A GLY 98 ? A GLY 98 473 19 Y 1 A ALA 99 ? A ALA 99 474 19 Y 1 A THR 100 ? A THR 100 475 19 Y 1 A TYR 101 ? A TYR 101 476 20 Y 1 A MET 1 ? A MET 1 477 20 Y 1 A SER 2 ? A SER 2 478 20 Y 1 A ASP 3 ? A ASP 3 479 20 Y 1 A SER 4 ? A SER 4 480 20 Y 1 A GLU 5 ? A GLU 5 481 20 Y 1 A VAL 6 ? A VAL 6 482 20 Y 1 A ASN 7 ? A ASN 7 483 20 Y 1 A GLN 8 ? A GLN 8 484 20 Y 1 A GLU 9 ? A GLU 9 485 20 Y 1 A ALA 10 ? A ALA 10 486 20 Y 1 A LYS 11 ? A LYS 11 487 20 Y 1 A PRO 12 ? A PRO 12 488 20 Y 1 A GLU 13 ? A GLU 13 489 20 Y 1 A VAL 14 ? A VAL 14 490 20 Y 1 A LYS 15 ? A LYS 15 491 20 Y 1 A PRO 16 ? A PRO 16 492 20 Y 1 A GLU 17 ? A GLU 17 493 20 Y 1 A VAL 18 ? A VAL 18 494 20 Y 1 A LYS 19 ? A LYS 19 495 20 Y 1 A PRO 20 ? A PRO 20 496 20 Y 1 A GLY 97 ? A GLY 97 497 20 Y 1 A GLY 98 ? A GLY 98 498 20 Y 1 A ALA 99 ? A ALA 99 499 20 Y 1 A THR 100 ? A THR 100 500 20 Y 1 A TYR 101 ? A TYR 101 #