data_1L47 # _entry.id 1L47 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1L47 pdb_00001l47 10.2210/pdb1l47/pdb WWPDB D_1000174574 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L47 _pdbx_database_status.recvd_initial_deposition_date 1991-01-28 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Daopin, S.' 1 'Matthews, B.W.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Cumulative site-directed charge-change replacements in bacteriophage T4 lysozyme suggest that long-range electrostatic interactions contribute little to protein stability. ; J.Mol.Biol. 221 873 887 1991 JMOBAK UK 0022-2836 0070 ? 1942034 '10.1016/0022-2836(91)80181-S' 2 'The Structural and Thermodynamic Consequences of Burying a Charged Residue within the Hydrophobic Core of T4 Lysozyme' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 3 ;Multiple Stabilizing Alanine Replacements within Alpha-Helix 126-134 of T4 Lysozyme Have Independent, Additive Effects on Both Structure and Stability ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 4 ;Tolerance of T4 Lysozyme to Proline Substitutions within the Long Interdomain Alpha-Helix Illustrates the Adaptability of Proteins to Potentially Destabilizing Lesions ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 5 ;Tolerance of T4 Lysozyme to Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 6 ;Analysis of the Interaction between Charged Side Chains and the Alpha-Helix Dipole Using Designed Thermostable Mutants of Phage T4 Lysozyme ; Biochemistry 30 9816 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 7 'Contributions of Engineered Surface Salt Bridges to the Stability of T4 Lysozyme Determined by Directed Mutagenesis' Biochemistry 30 7142 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 8 'Structural and Thermodynamic Analysis of the Packing of Two Alpha-Helices in Bacteriophage T4 Lysozyme' J.Mol.Biol. 221 647 ? 1991 JMOBAK UK 0022-2836 0070 ? ? ? 9 'Toward a Simplification of the Protein Folding Problem: A Stabilizing Polyalanine Alpha-Helix Engineered in T4 Lysozyme' Biochemistry 30 2012 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 10 ;Structure of a Thermostable Disulfide-Bridge Mutant of Phage T4 Lysozyme Shows that an Engineered Crosslink in a Flexible Region Does not Increase the Rigidity of the Folded Protein ; Biochemistry 29 2592 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 11 'Structural Studies of Mutants of T4 Lysozyme that Alter Hydrophobic Stabilization' J.Biol.Chem. 264 16059 ? 1989 JBCHA3 US 0021-9258 0071 ? ? ? 12 'High-Resolution Structure of the Temperature-Sensitive Mutant of Phage Lysozyme, Arg 96 (Right Arrow) His' Biochemistry 28 3793 ? 1989 BICHAW US 0006-2960 0033 ? ? ? 13 'Contributions of Left-Handed Helical Residues to the Structure and Stability of Bacteriophage T4 Lysozyme' J.Mol.Biol. 210 181 ? 1989 JMOBAK UK 0022-2836 0070 ? ? ? 14 'Hydrophobic Stabilization in T4 Lysozyme Determined Directly by Multiple Substitutions of Ile 3' Nature 334 406 ? 1988 NATUAS UK 0028-0836 0006 ? ? ? 15 'Enhanced Protein Thermostability from Designed Mutations that Interact with Alpha-Helix Dipoles' Nature 336 651 ? 1988 NATUAS UK 0028-0836 0006 ? ? ? 16 'Replacements of Pro86 in Phage T4 Lysozyme Extend an Alpha-Helix But Do not Alter Protein Stability' Science 239 631 ? 1988 SCIEAS US 0036-8075 0038 ? ? ? 17 'Enhanced Protein Thermostability from Site-Directed Mutations that Decrease the Entropy of Unfolding' Proc.Natl.Acad.Sci.USA 84 6663 ? 1987 PNASA6 US 0027-8424 0040 ? ? ? 18 'Structural Analysis of the Temperature-Sensitive Mutant of Bacteriophage T4 Lysozyme, Glycine 156 (Right Arrow) Aspartic Acid' J.Biol.Chem. 262 16858 ? 1987 JBCHA3 US 0021-9258 0071 ? ? ? 19 'Contributions of Hydrogen Bonds of Thr 157 to the Thermodynamic Stability of Phage T4 Lysozyme' Nature 330 41 ? 1987 NATUAS UK 0028-0836 0006 ? ? ? 20 ;Structural Studies of Mutants of the Lysozyme of Bacteriophage T4. The Temperature-Sensitive Mutant Protein Thr157 (Right Arrow) Ile ; J.Mol.Biol. 197 315 ? 1987 JMOBAK UK 0022-2836 0070 ? ? ? 21 'Structure of Bacteriophage T4 Lysozyme Refined at 1.7 Angstroms Resolution' J.Mol.Biol. 193 189 ? 1987 JMOBAK UK 0022-2836 0070 ? ? ? 22 ;Temperature-Sensitive Mutations of Bacteriophage T4 Lysozyme Occur at Sites with Low Mobility and Low Solvent Accessibility in the Folded Protein ; Biochemistry 26 3754 ? 1987 BICHAW US 0006-2960 0033 ? ? ? 23 'Common Precursor of Lysozymes of Hen Egg-White and Bacteriophage T4' Nature 290 334 ? 1981 NATUAS UK 0028-0836 0006 ? ? ? 24 ;Crystallographic Determination of the Mode of Binding of Oligosaccharides to T4 Bacteriophage Lysozyme. Implications for the Mechanism of Catalysis ; J.Mol.Biol. 147 523 ? 1981 JMOBAK UK 0022-2836 0070 ? ? ? 25 'Relation between Hen Egg White Lysozyme and Bacteriophage T4 Lysozyme. Evolutionary Implications' J.Mol.Biol. 147 545 ? 1981 JMOBAK UK 0022-2836 0070 ? ? ? 26 'Structure of the Lysozyme from Bacteriophage T4, an Electron Density Map at 2.4 Angstroms Resolution' J.Mol.Biol. 118 81 ? 1978 JMOBAK UK 0022-2836 0070 ? ? ? 27 'Atomic Coordinates for T4 Phage Lysozyme' Biochem.Biophys.Res.Commun. 75 265 ? 1977 BBRCA9 US 0006-291X 0146 ? ? ? 28 'Comparison of the Predicted and Observed Secondary Structure of T4 Phage Lysozyme' Biochim.Biophys.Acta 405 442 ? 1975 BBACAQ NE 0006-3002 0113 ? ? ? 29 'The Three Dimensional Structure of the Lysozyme from Bacteriophage T4' Proc.Natl.Acad.Sci.USA 71 4178 ? 1974 PNASA6 US 0027-8424 0040 ? ? ? 30 'Crystallographic Data for Lysozyme from Bacteriophage T4' J.Mol.Biol. 78 575 ? 1973 JMOBAK UK 0022-2836 0070 ? ? ? 1 ? 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sun, D.P.' 1 ? primary 'Soderlind, E.' 2 ? primary 'Baase, W.A.' 3 ? primary 'Wozniak, J.A.' 4 ? primary 'Sauer, U.' 5 ? primary 'Matthews, B.W.' 6 ? 1 'Nicholson, H.' 7 ? 1 'Becktel, W.' 8 ? 1 'Matthews, B.W.' 9 ? 2 'Daopin, S.' 10 ? 2 'Anderson, E.' 11 ? 2 'Baase, W.' 12 ? 2 'Dahlquist, F.W.' 13 ? 2 'Matthews, B.W.' 14 ? 3 'Zhang, X.-J.' 15 ? 3 'Baase, W.A.' 16 ? 3 'Matthews, B.W.' 17 ? 4 'Sauer, U.H.' 18 ? 4 'Dao-Pin, S.' 19 ? 4 'Matthews, B.W.' 20 ? 5 'Heinz, D.W.' 21 ? 5 'Baase, W.A.' 22 ? 5 'Matthews, B.W.' 23 ? 6 'Nicholson, H.' 24 ? 6 'Anderson, D.E.' 25 ? 6 'Dao-Pin, S.' 26 ? 6 'Matthews, B.W.' 27 ? 7 'Dao-Pin, S.' 28 ? 7 'Sauer, U.' 29 ? 7 'Nicholson, H.' 30 ? 7 'Matthews, B.W.' 31 ? 8 'Daopin, S.' 32 ? 8 'Alber, T.' 33 ? 8 'Baase, W.A.' 34 ? 8 'Wozniak, J.A.' 35 ? 8 'Matthews, B.W.' 36 ? 9 'Zhang, X.-J.' 37 ? 9 'Baase, W.A.' 38 ? 9 'Matthews, B.W.' 39 ? 10 'Pjura, P.E.' 40 ? 10 'Matsumura, M.' 41 ? 10 'Wozniak, J.A.' 42 ? 10 'Matthews, B.W.' 43 ? 11 'Matsumura, M.' 44 ? 11 'Wozniak, J.A.' 45 ? 11 'Dao-Pin, S.' 46 ? 11 'Matthews, B.W.' 47 ? 12 'Weaver, L.H.' 48 ? 12 'Gray, T.M.' 49 ? 12 'Gruetter, M.G.' 50 ? 12 'Anderson, D.E.' 51 ? 12 'Wozniak, J.A.' 52 ? 12 'Dahlquist, F.W.' 53 ? 12 'Matthews, B.W.' 54 ? 13 'Nicholson, H.' 55 ? 13 'Soderlind, E.' 56 ? 13 'Tronrud, D.E.' 57 ? 13 'Matthews, B.W.' 58 ? 14 'Matsumura, M.' 59 ? 14 'Becktel, W.J.' 60 ? 14 'Matthews, B.W.' 61 ? 15 'Nicholson, H.' 62 ? 15 'Becktel, W.J.' 63 ? 15 'Matthews, B.W.' 64 ? 16 'Alber, T.' 65 ? 16 'Bell, J.A.' 66 ? 16 'Dao-Pin, S.' 67 ? 16 'Nicholson, H.' 68 ? 16 'Wozniak, J.A.' 69 ? 16 'Cook, S.' 70 ? 16 'Matthews, B.W.' 71 ? 17 'Matthews, B.W.' 72 ? 17 'Nicholson, H.' 73 ? 17 'Becktel, W.J.' 74 ? 18 'Gray, T.M.' 75 ? 18 'Matthews, B.W.' 76 ? 19 'Alber, T.' 77 ? 19 'Dao-Pin, S.' 78 ? 19 'Wilson, K.' 79 ? 19 'Wozniak, J.A.' 80 ? 19 'Cook, S.P.' 81 ? 19 'Matthews, B.W.' 82 ? 20 'Gruetter, M.G.' 83 ? 20 'Gray, T.M.' 84 ? 20 'Weaver, L.H.' 85 ? 20 'Alber, T.' 86 ? 20 'Wilson, K.' 87 ? 20 'Matthews, B.W.' 88 ? 21 'Weaver, L.H.' 89 ? 21 'Matthews, B.W.' 90 ? 22 'Alber, T.' 91 ? 22 'Dao-Pin, S.' 92 ? 22 'Nye, J.A.' 93 ? 22 'Muchmore, D.C.' 94 ? 22 'Matthews, B.W.' 95 ? 23 'Matthews, B.W.' 96 ? 23 'Gruetter, M.G.' 97 ? 23 'Anderson, W.F.' 98 ? 23 'Remington, S.J.' 99 ? 24 'Anderson, W.F.' 100 ? 24 'Gruetter, M.G.' 101 ? 24 'Remington, S.J.' 102 ? 24 'Weaver, L.H.' 103 ? 24 'Matthews, B.W.' 104 ? 25 'Matthews, B.W.' 105 ? 25 'Remington, S.J.' 106 ? 25 'Gruetter, M.G.' 107 ? 25 'Anderson, W.F.' 108 ? 26 'Remington, S.J.' 109 ? 26 'Anderson, W.F.' 110 ? 26 'Owen, J.' 111 ? 26 'Teneyck, L.F.' 112 ? 26 'Grainger, C.T.' 113 ? 26 'Matthews, B.W.' 114 ? 27 'Remington, S.J.' 115 ? 27 'Teneyck, L.F.' 116 ? 27 'Matthews, B.W.' 117 ? 28 'Matthews, B.W.' 118 ? 29 'Matthews, B.W.' 119 ? 29 'Remington, S.J.' 120 ? 30 'Matthews, B.W.' 121 ? 30 'Dahlquist, F.W.' 122 ? 30 'Maynard, A.Y.' 123 ? # _cell.entry_id 1L47 _cell.length_a 60.900 _cell.length_b 60.900 _cell.length_c 97.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1L47 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'T4 LYSOZYME' 18634.387 1 3.2.1.17 ? ? ? 2 water nat water 18.015 151 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFETGTWDA YKNL ; _entity_poly.pdbx_seq_one_letter_code_can ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFETGTWDA YKNL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ILE n 1 4 PHE n 1 5 GLU n 1 6 MET n 1 7 LEU n 1 8 ARG n 1 9 ILE n 1 10 ASP n 1 11 GLU n 1 12 GLY n 1 13 LEU n 1 14 ARG n 1 15 LEU n 1 16 LYS n 1 17 ILE n 1 18 TYR n 1 19 LYS n 1 20 ASP n 1 21 THR n 1 22 GLU n 1 23 GLY n 1 24 TYR n 1 25 TYR n 1 26 THR n 1 27 ILE n 1 28 GLY n 1 29 ILE n 1 30 GLY n 1 31 HIS n 1 32 LEU n 1 33 LEU n 1 34 THR n 1 35 LYS n 1 36 SER n 1 37 PRO n 1 38 SER n 1 39 LEU n 1 40 ASN n 1 41 ALA n 1 42 ALA n 1 43 LYS n 1 44 SER n 1 45 GLU n 1 46 LEU n 1 47 ASP n 1 48 LYS n 1 49 ALA n 1 50 ILE n 1 51 GLY n 1 52 ARG n 1 53 ASN n 1 54 CYS n 1 55 ASN n 1 56 GLY n 1 57 VAL n 1 58 ILE n 1 59 THR n 1 60 LYS n 1 61 ASP n 1 62 GLU n 1 63 ALA n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 ASN n 1 69 GLN n 1 70 ASP n 1 71 VAL n 1 72 ASP n 1 73 ALA n 1 74 ALA n 1 75 VAL n 1 76 ARG n 1 77 GLY n 1 78 ILE n 1 79 LEU n 1 80 ARG n 1 81 ASN n 1 82 ALA n 1 83 LYS n 1 84 LEU n 1 85 LYS n 1 86 PRO n 1 87 VAL n 1 88 TYR n 1 89 ASP n 1 90 SER n 1 91 LEU n 1 92 ASP n 1 93 ALA n 1 94 VAL n 1 95 ARG n 1 96 ARG n 1 97 CYS n 1 98 ALA n 1 99 LEU n 1 100 ILE n 1 101 ASN n 1 102 MET n 1 103 VAL n 1 104 PHE n 1 105 GLN n 1 106 MET n 1 107 GLY n 1 108 GLU n 1 109 THR n 1 110 GLY n 1 111 VAL n 1 112 ALA n 1 113 GLY n 1 114 PHE n 1 115 THR n 1 116 ASN n 1 117 SER n 1 118 LEU n 1 119 ARG n 1 120 MET n 1 121 LEU n 1 122 GLN n 1 123 GLN n 1 124 LYS n 1 125 ARG n 1 126 TRP n 1 127 ASP n 1 128 GLU n 1 129 ALA n 1 130 ALA n 1 131 VAL n 1 132 ASN n 1 133 LEU n 1 134 ALA n 1 135 LYS n 1 136 SER n 1 137 ARG n 1 138 TRP n 1 139 TYR n 1 140 ASN n 1 141 GLN n 1 142 THR n 1 143 PRO n 1 144 ASN n 1 145 ARG n 1 146 ALA n 1 147 LYS n 1 148 ARG n 1 149 VAL n 1 150 ILE n 1 151 THR n 1 152 THR n 1 153 PHE n 1 154 GLU n 1 155 THR n 1 156 GLY n 1 157 THR n 1 158 TRP n 1 159 ASP n 1 160 ALA n 1 161 TYR n 1 162 LYS n 1 163 ASN n 1 164 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'T4-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Enterobacteria phage T4 sensu lato' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name M13 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYS_BPT4 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00720 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L47 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 164 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00720 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1L47 _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 154 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00720 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 154 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 154 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1L47 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_percent_sol 55.85 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1L47 _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.0 _refine.ls_d_res_high 1.70 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1550000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;RESIDUES 162 - 164 IN WILD-TYPE AND ALL MUTANT LYSOZYMES ARE EXTREMELY MOBILE. THUS THE COORDINATES FOR THESE RESIDUES ARE VERY UNRELIABLE. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1307 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 151 _refine_hist.number_atoms_total 1458 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 6.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.018 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 2.40 ? ? ? 'X-RAY DIFFRACTION' ? t_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_gen_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_it ? ? ? ? 'X-RAY DIFFRACTION' ? t_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1L47 _struct.title ;CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L47 _struct_keywords.pdbx_keywords 'HYDROLASE (O-GLYCOSYL)' _struct_keywords.text 'HYDROLASE (O-GLYCOSYL)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ILE A 3 ? GLU A 11 ? ILE A 3 GLU A 11 1 ? 9 HELX_P HELX_P2 H2 LEU A 39 ? ILE A 50 ? LEU A 39 ILE A 50 1 ? 12 HELX_P HELX_P3 H3 LYS A 60 ? ARG A 80 ? LYS A 60 ARG A 80 1 ? 21 HELX_P HELX_P4 H4 ALA A 82 ? SER A 90 ? ALA A 82 SER A 90 1 ? 9 HELX_P HELX_P5 H5 ALA A 93 ? MET A 106 ? ALA A 93 MET A 106 1 ? 14 HELX_P HELX_P6 H6 GLU A 108 ? GLY A 113 ? GLU A 108 GLY A 113 1 ? 6 HELX_P HELX_P7 H7 THR A 115 ? GLN A 123 ? THR A 115 GLN A 123 1 ? 9 HELX_P HELX_P8 H8 TRP A 126 ? ALA A 134 ? TRP A 126 ALA A 134 1 ? 9 HELX_P HELX_P9 H9 ARG A 137 ? GLN A 141 ? ARG A 137 GLN A 141 1 ? 5 HELX_P HELX_P10 H10 PRO A 143 ? THR A 155 ? PRO A 143 THR A 155 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 GLY A 56 ? ILE A 58 ? GLY A 56 ILE A 58 S1 2 ARG A 14 ? ASP A 20 ? ARG A 14 ASP A 20 S1 3 TYR A 24 ? ILE A 27 ? TYR A 24 ILE A 27 S1 4 HIS A 31 ? LEU A 33 ? HIS A 31 LEU A 33 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N ILE A 58 ? N ILE A 58 O LEU A 15 ? O LEU A 15 S1 2 3 N ASP A 20 ? N ASP A 20 O TYR A 24 ? O TYR A 24 S1 3 4 O ILE A 27 ? O ILE A 27 N HIS A 31 ? N HIS A 31 # _database_PDB_matrix.entry_id 1L47 _database_PDB_matrix.origx[1][1] 0.866025 _database_PDB_matrix.origx[1][2] 0.500000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx[2][1] -0.500000 _database_PDB_matrix.origx[2][2] 0.866025 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 1L47 _atom_sites.fract_transf_matrix[1][1] 0.016420 _atom_sites.fract_transf_matrix[1][2] 0.009480 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018961 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010309 _atom_sites.fract_transf_vector[3] 0.000000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text ;RESIDUES 162 - 164 IN WILD-TYPE AND ALL MUTANT LYSOZYMES ARE EXTREMELY MOBILE. THUS THE COORDINATES FOR THESE RESIDUES ARE VERY UNRELIABLE. ; # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 LEU 164 164 164 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 166 166 HOH HOH A . B 2 HOH 2 167 167 HOH HOH A . B 2 HOH 3 168 168 HOH HOH A . B 2 HOH 4 169 169 HOH HOH A . B 2 HOH 5 170 170 HOH HOH A . B 2 HOH 6 171 171 HOH HOH A . B 2 HOH 7 172 172 HOH HOH A . B 2 HOH 8 173 173 HOH HOH A . B 2 HOH 9 175 175 HOH HOH A . B 2 HOH 10 176 176 HOH HOH A . B 2 HOH 11 178 178 HOH HOH A . B 2 HOH 12 179 179 HOH HOH A . B 2 HOH 13 180 180 HOH HOH A . B 2 HOH 14 181 181 HOH HOH A . B 2 HOH 15 182 182 HOH HOH A . B 2 HOH 16 184 184 HOH HOH A . B 2 HOH 17 185 185 HOH HOH A . B 2 HOH 18 186 186 HOH HOH A . B 2 HOH 19 187 187 HOH HOH A . B 2 HOH 20 188 188 HOH HOH A . B 2 HOH 21 190 190 HOH HOH A . B 2 HOH 22 191 191 HOH HOH A . B 2 HOH 23 192 192 HOH HOH A . B 2 HOH 24 194 194 HOH HOH A . B 2 HOH 25 195 195 HOH HOH A . B 2 HOH 26 197 197 HOH HOH A . B 2 HOH 27 201 201 HOH HOH A . B 2 HOH 28 203 203 HOH HOH A . B 2 HOH 29 204 204 HOH HOH A . B 2 HOH 30 206 206 HOH HOH A . B 2 HOH 31 207 207 HOH HOH A . B 2 HOH 32 208 208 HOH HOH A . B 2 HOH 33 209 209 HOH HOH A . B 2 HOH 34 211 211 HOH HOH A . B 2 HOH 35 212 212 HOH HOH A . B 2 HOH 36 213 213 HOH HOH A . B 2 HOH 37 214 214 HOH HOH A . B 2 HOH 38 215 215 HOH HOH A . B 2 HOH 39 216 216 HOH HOH A . B 2 HOH 40 217 217 HOH HOH A . B 2 HOH 41 218 218 HOH HOH A . B 2 HOH 42 219 219 HOH HOH A . B 2 HOH 43 220 220 HOH HOH A . B 2 HOH 44 221 221 HOH HOH A . B 2 HOH 45 222 222 HOH HOH A . B 2 HOH 46 223 223 HOH HOH A . B 2 HOH 47 227 227 HOH HOH A . B 2 HOH 48 229 229 HOH HOH A . B 2 HOH 49 230 230 HOH HOH A . B 2 HOH 50 232 232 HOH HOH A . B 2 HOH 51 233 233 HOH HOH A . B 2 HOH 52 235 235 HOH HOH A . B 2 HOH 53 237 237 HOH HOH A . B 2 HOH 54 238 238 HOH HOH A . B 2 HOH 55 239 239 HOH HOH A . B 2 HOH 56 240 240 HOH HOH A . B 2 HOH 57 241 241 HOH HOH A . B 2 HOH 58 242 242 HOH HOH A . B 2 HOH 59 243 243 HOH HOH A . B 2 HOH 60 244 244 HOH HOH A . B 2 HOH 61 246 246 HOH HOH A . B 2 HOH 62 247 247 HOH HOH A . B 2 HOH 63 250 250 HOH HOH A . B 2 HOH 64 252 252 HOH HOH A . B 2 HOH 65 256 256 HOH HOH A . B 2 HOH 66 260 260 HOH HOH A . B 2 HOH 67 261 261 HOH HOH A . B 2 HOH 68 265 265 HOH HOH A . B 2 HOH 69 268 268 HOH HOH A . B 2 HOH 70 269 269 HOH HOH A . B 2 HOH 71 270 270 HOH HOH A . B 2 HOH 72 273 273 HOH HOH A . B 2 HOH 73 274 274 HOH HOH A . B 2 HOH 74 275 275 HOH HOH A . B 2 HOH 75 277 277 HOH HOH A . B 2 HOH 76 280 280 HOH HOH A . B 2 HOH 77 282 282 HOH HOH A . B 2 HOH 78 287 287 HOH HOH A . B 2 HOH 79 290 290 HOH HOH A . B 2 HOH 80 295 295 HOH HOH A . B 2 HOH 81 297 297 HOH HOH A . B 2 HOH 82 298 298 HOH HOH A . B 2 HOH 83 303 303 HOH HOH A . B 2 HOH 84 304 304 HOH HOH A . B 2 HOH 85 312 312 HOH HOH A . B 2 HOH 86 314 314 HOH HOH A . B 2 HOH 87 315 315 HOH HOH A . B 2 HOH 88 316 316 HOH HOH A . B 2 HOH 89 317 317 HOH HOH A . B 2 HOH 90 318 318 HOH HOH A . B 2 HOH 91 319 319 HOH HOH A . B 2 HOH 92 321 321 HOH HOH A . B 2 HOH 93 324 324 HOH HOH A . B 2 HOH 94 326 326 HOH HOH A . B 2 HOH 95 327 327 HOH HOH A . B 2 HOH 96 333 333 HOH HOH A . B 2 HOH 97 338 338 HOH HOH A . B 2 HOH 98 340 340 HOH HOH A . B 2 HOH 99 348 348 HOH HOH A . B 2 HOH 100 351 351 HOH HOH A . B 2 HOH 101 352 352 HOH HOH A . B 2 HOH 102 353 353 HOH HOH A . B 2 HOH 103 355 355 HOH HOH A . B 2 HOH 104 356 356 HOH HOH A . B 2 HOH 105 361 361 HOH HOH A . B 2 HOH 106 363 363 HOH HOH A . B 2 HOH 107 364 364 HOH HOH A . B 2 HOH 108 401 401 HOH HOH A . B 2 HOH 109 402 402 HOH HOH A . B 2 HOH 110 403 403 HOH HOH A . B 2 HOH 111 404 404 HOH HOH A . B 2 HOH 112 405 405 HOH HOH A . B 2 HOH 113 407 407 HOH HOH A . B 2 HOH 114 408 408 HOH HOH A . B 2 HOH 115 411 411 HOH HOH A . B 2 HOH 116 412 412 HOH HOH A . B 2 HOH 117 414 414 HOH HOH A . B 2 HOH 118 415 415 HOH HOH A . B 2 HOH 119 417 417 HOH HOH A . B 2 HOH 120 418 418 HOH HOH A . B 2 HOH 121 419 419 HOH HOH A . B 2 HOH 122 420 420 HOH HOH A . B 2 HOH 123 517 517 HOH HOH A . B 2 HOH 124 518 518 HOH HOH A . B 2 HOH 125 519 519 HOH HOH A . B 2 HOH 126 520 520 HOH HOH A . B 2 HOH 127 523 523 HOH HOH A . B 2 HOH 128 524 524 HOH HOH A . B 2 HOH 129 525 525 HOH HOH A . B 2 HOH 130 526 526 HOH HOH A . B 2 HOH 131 527 527 HOH HOH A . B 2 HOH 132 528 528 HOH HOH A . B 2 HOH 133 529 529 HOH HOH A . B 2 HOH 134 530 530 HOH HOH A . B 2 HOH 135 531 531 HOH HOH A . B 2 HOH 136 532 532 HOH HOH A . B 2 HOH 137 533 533 HOH HOH A . B 2 HOH 138 534 534 HOH HOH A . B 2 HOH 139 537 537 HOH HOH A . B 2 HOH 140 538 538 HOH HOH A . B 2 HOH 141 539 539 HOH HOH A . B 2 HOH 142 540 540 HOH HOH A . B 2 HOH 143 541 541 HOH HOH A . B 2 HOH 144 542 542 HOH HOH A . B 2 HOH 145 543 543 HOH HOH A . B 2 HOH 146 544 544 HOH HOH A . B 2 HOH 147 545 545 HOH HOH A . B 2 HOH 148 546 546 HOH HOH A . B 2 HOH 149 547 547 HOH HOH A . B 2 HOH 150 548 548 HOH HOH A . B 2 HOH 151 549 549 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1991-10-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 2 0 2022-11-23 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation ? 'ORTHOGONAL X,Y,Z AXES WERE REALIGNED FROM A*,B,C TO A,B*,C CRYSTALLOGRAPHIC DIRECTIONS' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' Advisory 7 5 'Structure model' 'Atomic model' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' Other 11 5 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type 4 5 'Structure model' atom_site 5 5 'Structure model' atom_sites 6 5 'Structure model' citation_author 7 5 'Structure model' database_2 8 5 'Structure model' database_PDB_matrix 9 5 'Structure model' entity_src_gen 10 5 'Structure model' pdbx_database_remark 11 5 'Structure model' pdbx_validate_rmsd_angle 12 5 'Structure model' pdbx_validate_rmsd_bond 13 5 'Structure model' pdbx_validate_torsion 14 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_atom_site.Cartn_x' 3 5 'Structure model' '_atom_site.Cartn_y' 4 5 'Structure model' '_atom_sites.fract_transf_matrix[1][1]' 5 5 'Structure model' '_atom_sites.fract_transf_matrix[1][2]' 6 5 'Structure model' '_atom_sites.fract_transf_matrix[2][1]' 7 5 'Structure model' '_atom_sites.fract_transf_matrix[2][2]' 8 5 'Structure model' '_database_2.pdbx_DOI' 9 5 'Structure model' '_database_2.pdbx_database_accession' 10 5 'Structure model' '_database_PDB_matrix.origx[1][1]' 11 5 'Structure model' '_database_PDB_matrix.origx[1][2]' 12 5 'Structure model' '_database_PDB_matrix.origx[2][1]' 13 5 'Structure model' '_database_PDB_matrix.origx[2][2]' 14 5 'Structure model' '_entity_src_gen.pdbx_gene_src_organ' 15 5 'Structure model' '_pdbx_validate_rmsd_angle.angle_deviation' 16 5 'Structure model' '_pdbx_validate_rmsd_angle.angle_value' 17 5 'Structure model' '_pdbx_validate_rmsd_bond.bond_deviation' 18 5 'Structure model' '_pdbx_validate_rmsd_bond.bond_value' 19 5 'Structure model' '_pdbx_validate_torsion.phi' 20 5 'Structure model' '_pdbx_validate_torsion.psi' 21 5 'Structure model' '_struct_ref_seq_dif.details' # _software.name TNT _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET THERE ARE SEVERAL SUBTLE ASPECTS OF THE SECONDARY STRUCTURE OF THIS MOLECULE WHICH CANNOT CONVENIENTLY BE REPRESENTED IN THE HELIX AND SHEET RECORDS BELOW. THESE ASPECTS INFLUENCE THE REPRESENTATION OF HELIX 6 AND STRAND 3 OF SHEET *S1*. THE PAPER CITED AS REFERENCE 26 ABOVE SHOULD BE CONSULTED FOR THESE SUBTLETIES. ; # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 128 ? ? OE2 A GLU 128 ? ? 1.325 1.252 0.073 0.011 N 2 1 CD A GLU 154 ? ? OE2 A GLU 154 ? ? 1.325 1.252 0.073 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 125.57 120.30 5.27 0.50 N 2 1 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 125.63 120.30 5.33 0.50 N 3 1 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH2 A ARG 14 ? ? 117.23 120.30 -3.07 0.50 N 4 1 CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 125.14 118.30 6.84 0.90 N 5 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD1 A ASP 47 ? ? 126.57 118.30 8.27 0.90 N 6 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD2 A ASP 47 ? ? 109.23 118.30 -9.07 0.90 N 7 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD2 A ASP 61 ? ? 111.42 118.30 -6.88 0.90 N 8 1 CB A ASP 70 ? ? CG A ASP 70 ? ? OD1 A ASP 70 ? ? 125.08 118.30 6.78 0.90 N 9 1 CB A ASP 72 ? ? CG A ASP 72 ? ? OD1 A ASP 72 ? ? 124.89 118.30 6.59 0.90 N 10 1 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 127.15 120.30 6.85 0.50 N 11 1 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH2 A ARG 80 ? ? 114.95 120.30 -5.35 0.50 N 12 1 CB A ASP 92 ? ? CG A ASP 92 ? ? OD1 A ASP 92 ? ? 124.73 118.30 6.43 0.90 N 13 1 CB A ASP 92 ? ? CG A ASP 92 ? ? OD2 A ASP 92 ? ? 111.05 118.30 -7.25 0.90 N 14 1 CA A MET 106 ? ? CB A MET 106 ? ? CG A MET 106 ? ? 124.30 113.30 11.00 1.70 N 15 1 N A ASN 163 ? ? CA A ASN 163 ? ? CB A ASN 163 ? ? 95.55 110.60 -15.05 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 29 ? ? -101.83 71.78 2 1 ARG A 125 ? ? -100.36 77.45 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #