data_1L72 # _entry.id 1L72 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1L72 WWPDB D_1000174599 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L72 _pdbx_database_status.recvd_initial_deposition_date 1991-09-23 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, X.' 1 'Matthews, B.W.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Multiple alanine replacements within alpha-helix 126-134 of T4 lysozyme have independent, additive effects on both structure and stability. ; 'Protein Sci.' 1 761 776 1992 PRCIEI US 0961-8368 0795 ? 1304917 ? 2 'The Structural and Thermodynamic Consequences of Burying a Charged Residue within the Hydrophobic Core of T4 Lysozyme' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 3 ;Tolerance of T4 Lysozyme to Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 4 ;Tolerance of T4 Lysozyme to Proline Substitutions within the Long Interdomain Alpha-Helix Illustrates the Adaptability of Proteins to Potentially Destabilizing Lesions ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 5 ;Cumulative Site-Directed Charge-Change Replacements in Bacteriophage T4 Lysozyme Suggest that Long-Range Electrostatic Interactions Contribute Little to Protein Stability ; J.Mol.Biol. 221 873 ? 1991 JMOBAK UK 0022-2836 0070 ? ? ? 6 ;Analysis of the Interaction between Charged Side Chains and the Alpha-Helix Dipole Using Designed Thermostable Mutants of Phage T4 Lysozyme ; Biochemistry 30 9816 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 7 'Structural and Thermodynamic Analysis of the Packing of Two Alpha-Helices in Bacteriophage T4 Lysozyme' J.Mol.Biol. 221 647 ? 1991 JMOBAK UK 0022-2836 0070 ? ? ? 8 'Contributions of Engineered Surface Salt Bridges to the Stability of T4 Lysozyme Determined by Directed Mutagenesis' Biochemistry 30 7142 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 9 'Toward a Simplification of the Protein Folding Problem: A Stabilizing Polyalanine Alpha-Helix Engineered in T4 Lysozyme' Biochemistry 30 2012 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 10 ;Structure of a Thermostable Disulfide-Bridge Mutant of Phage T4 Lysozyme Shows that an Engineered Crosslink in a Flexible Region Does not Increase the Rigidity of the Folded Protein ; Biochemistry 29 2592 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 11 'Structural Studies of Mutants of T4 Lysozyme that Alter Hydrophobic Stabilization' J.Biol.Chem. 264 16059 ? 1989 JBCHA3 US 0021-9258 0071 ? ? ? 12 'High-Resolution Structure of the Temperature-Sensitive Mutant of Phage Lysozyme, Arg 96 (Right Arrow) His' Biochemistry 28 3793 ? 1989 BICHAW US 0006-2960 0033 ? ? ? 13 'Contributions of Left-Handed Helical Residues to the Structure and Stability of Bacteriophage T4 Lysozyme' J.Mol.Biol. 210 181 ? 1989 JMOBAK UK 0022-2836 0070 ? ? ? 14 'Hydrophobic Stabilization in T4 Lysozyme Determined Directly by Multiple Substitutions of Ile 3' Nature 334 406 ? 1988 NATUAS UK 0028-0836 0006 ? ? ? 15 'Enhanced Protein Thermostability from Designed Mutations that Interact with Alpha-Helix Dipoles' Nature 336 651 ? 1988 NATUAS UK 0028-0836 0006 ? ? ? 16 'Replacements of Pro86 in Phage T4 Lysozyme Extend an Alpha-Helix But Do not Alter Protein Stability' Science 239 631 ? 1988 SCIEAS US 0036-8075 0038 ? ? ? 17 'Enhanced Protein Thermostability from Site-Directed Mutations that Decrease the Entropy of Unfolding' Proc.Natl.Acad.Sci.USA 84 6663 ? 1987 PNASA6 US 0027-8424 0040 ? ? ? 18 'Structural Analysis of the Temperature-Sensitive Mutant of Bacteriophage T4 Lysozyme, Glycine 156 (Right Arrow) Aspartic Acid' J.Biol.Chem. 262 16858 ? 1987 JBCHA3 US 0021-9258 0071 ? ? ? 19 'Contributions of Hydrogen Bonds of Thr 157 to the Thermodynamic Stability of Phage T4 Lysozyme' Nature 330 41 ? 1987 NATUAS UK 0028-0836 0006 ? ? ? 20 ;Structural Studies of Mutants of the Lysozyme of Bacteriophage T4. The Temperature-Sensitive Mutant Protein Thr157 (Right Arrow) Ile ; J.Mol.Biol. 197 315 ? 1987 JMOBAK UK 0022-2836 0070 ? ? ? 21 'Structure of Bacteriophage T4 Lysozyme Refined at 1.7 Angstroms Resolution' J.Mol.Biol. 193 189 ? 1987 JMOBAK UK 0022-2836 0070 ? ? ? 22 ;Temperature-Sensitive Mutations of Bacteriophage T4 Lysozyme Occur at Sites with Low Mobility and Low Solvent Accessibility in the Folded Protein ; Biochemistry 26 3754 ? 1987 BICHAW US 0006-2960 0033 ? ? ? 23 'Common Precursor of Lysozymes of Hen Egg-White and Bacteriophage T4' Nature 290 334 ? 1981 NATUAS UK 0028-0836 0006 ? ? ? 24 ;Crystallographic Determination of the Mode of Binding of Oligosaccharides to T4 Bacteriophage Lysozyme. Implications for the Mechanism of Catalysis ; J.Mol.Biol. 147 523 ? 1981 JMOBAK UK 0022-2836 0070 ? ? ? 25 'Relation between Hen Egg White Lysozyme and Bacteriophage T4 Lysozyme. Evolutionary Implications' J.Mol.Biol. 147 545 ? 1981 JMOBAK UK 0022-2836 0070 ? ? ? 26 'Structure of the Lysozyme from Bacteriophage T4, an Electron Density Map at 2.4 Angstroms Resolution' J.Mol.Biol. 118 81 ? 1978 JMOBAK UK 0022-2836 0070 ? ? ? 27 'Atomic Coordinates for T4 Phage Lysozyme' Biochem.Biophys.Res.Commun. 75 265 ? 1977 BBRCA9 US 0006-291X 0146 ? ? ? 28 'Comparison of the Predicted and Observed Secondary Structure of T4 Phage Lysozyme' Biochim.Biophys.Acta 405 442 ? 1975 BBACAQ NE 0006-3002 0113 ? ? ? 29 'The Three Dimensional Structure of the Lysozyme from Bacteriophage T4' Proc.Natl.Acad.Sci.USA 71 4178 ? 1974 PNASA6 US 0027-8424 0040 ? ? ? 30 'Crystallographic Data for Lysozyme from Bacteriophage T4' J.Mol.Biol. 78 575 ? 1973 JMOBAK UK 0022-2836 0070 ? ? ? 1 ? 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, X.J.' 1 primary 'Baase, W.A.' 2 primary 'Matthews, B.W.' 3 1 'Nicholson, H.' 4 1 'Becktel, W.' 5 1 'Matthews, B.W.' 6 2 'Daopin, S.' 7 2 'Anderson, E.' 8 2 'Baase, W.' 9 2 'Dahlquist, F.W.' 10 2 'Matthews, B.W.' 11 3 'Heinz, D.W.' 12 3 'Baase, W.A.' 13 3 'Matthews, B.W.' 14 4 'Sauer, U.H.' 15 4 'Dao-Pin, S.' 16 4 'Matthews, B.W.' 17 5 'Dao-Pin, S.' 18 5 'Soderlind, E.' 19 5 'Baase, W.A.' 20 5 'Wozniak, J.A.' 21 5 'Sauer, U.' 22 5 'Matthews, B.W.' 23 6 'Nicholson, H.' 24 6 'Anderson, D.E.' 25 6 'Dao-Pin, S.' 26 6 'Matthews, B.W.' 27 7 'Daopin, S.' 28 7 'Alber, T.' 29 7 'Baase, W.A.' 30 7 'Wozniak, J.A.' 31 7 'Matthews, B.W.' 32 8 'Dao-Pin, S.' 33 8 'Sauer, U.' 34 8 'Nicholson, H.' 35 8 'Matthews, B.W.' 36 9 'Zhang, X.-J.' 37 9 'Baase, W.A.' 38 9 'Matthews, B.W.' 39 10 'Pjura, P.E.' 40 10 'Matsumura, M.' 41 10 'Wozniak, J.A.' 42 10 'Matthews, B.W.' 43 11 'Matsumura, M.' 44 11 'Wozniak, J.A.' 45 11 'Dao-Pin, S.' 46 11 'Matthews, B.W.' 47 12 'Weaver, L.H.' 48 12 'Gray, T.M.' 49 12 'Gruetter, M.G.' 50 12 'Anderson, D.E.' 51 12 'Wozniak, J.A.' 52 12 'Dahlquist, F.W.' 53 12 'Matthews, B.W.' 54 13 'Nicholson, H.' 55 13 'Soderlind, E.' 56 13 'Tronrud, D.E.' 57 13 'Matthews, B.W.' 58 14 'Matsumura, M.' 59 14 'Becktel, W.J.' 60 14 'Matthews, B.W.' 61 15 'Nicholson, H.' 62 15 'Becktel, W.J.' 63 15 'Matthews, B.W.' 64 16 'Alber, T.' 65 16 'Bell, J.A.' 66 16 'Dao-Pin, S.' 67 16 'Nicholson, H.' 68 16 'Cook, J.A.Wozniak S.' 69 16 'Matthews, B.W.' 70 17 'Matthews, B.W.' 71 17 'Nicholson, H.' 72 17 'Becktel, W.J.' 73 18 'Gray, T.M.' 74 18 'Matthews, B.W.' 75 19 'Alber, T.' 76 19 'Dao-Pin, S.' 77 19 'Wilson, K.' 78 19 'Wozniak, J.A.' 79 19 'Cook, S.P.' 80 19 'Matthews, B.W.' 81 20 'Gruetter, M.G.' 82 20 'Gray, T.M.' 83 20 'Weaver, L.H.' 84 20 'Alber, T.' 85 20 'Wilson, K.' 86 20 'Matthews, B.W.' 87 21 'Weaver, L.H.' 88 21 'Matthews, B.W.' 89 22 'Alber, T.' 90 22 'Dao-Pin, S.' 91 22 'Nye, J.A.' 92 22 'Muchmore, D.C.' 93 22 'Matthews, B.W.' 94 23 'Matthews, B.W.' 95 23 'Gruetter, M.G.' 96 23 'Anderson, W.F.' 97 23 'Remington, S.J.' 98 24 'Anderson, W.F.' 99 24 'Gruetter, M.G.' 100 24 'Remington, S.J.' 101 24 'Weaver, L.H.' 102 24 'Matthews, B.W.' 103 25 'Matthews, B.W.' 104 25 'Remington, S.J.' 105 25 'Gruetter, M.G.' 106 25 'Anderson, W.F.' 107 26 'Remington, S.J.' 108 26 'Anderson, W.F.' 109 26 'Owen, J.' 110 26 'Teneyck, L.F.' 111 26 'Grainger, C.T.' 112 26 'Matthews, B.W.' 113 27 'Remington, S.J.' 114 27 'Teneyck, L.F.' 115 27 'Matthews, B.W.' 116 28 'Matthews, B.W.' 117 29 'Matthews, B.W.' 118 29 'Remington, S.J.' 119 30 'Matthews, B.W.' 120 30 'Dahlquist, F.W.' 121 30 'Maynard, A.Y.' 122 # _cell.entry_id 1L72 _cell.length_a 61.100 _cell.length_b 61.100 _cell.length_c 95.750 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1L72 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man LYSOZYME 18560.422 1 3.2.1.17 ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 3 non-polymer syn BETA-MERCAPTOETHANOL 78.133 2 ? ? ? ? 4 water nat water 18.015 137 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWAAAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _entity_poly.pdbx_seq_one_letter_code_can ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWAAAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ILE n 1 4 PHE n 1 5 GLU n 1 6 MET n 1 7 LEU n 1 8 ARG n 1 9 ILE n 1 10 ASP n 1 11 GLU n 1 12 GLY n 1 13 LEU n 1 14 ARG n 1 15 LEU n 1 16 LYS n 1 17 ILE n 1 18 TYR n 1 19 LYS n 1 20 ASP n 1 21 THR n 1 22 GLU n 1 23 GLY n 1 24 TYR n 1 25 TYR n 1 26 THR n 1 27 ILE n 1 28 GLY n 1 29 ILE n 1 30 GLY n 1 31 HIS n 1 32 LEU n 1 33 LEU n 1 34 THR n 1 35 LYS n 1 36 SER n 1 37 PRO n 1 38 SER n 1 39 LEU n 1 40 ASN n 1 41 ALA n 1 42 ALA n 1 43 LYS n 1 44 SER n 1 45 GLU n 1 46 LEU n 1 47 ASP n 1 48 LYS n 1 49 ALA n 1 50 ILE n 1 51 GLY n 1 52 ARG n 1 53 ASN n 1 54 CYS n 1 55 ASN n 1 56 GLY n 1 57 VAL n 1 58 ILE n 1 59 THR n 1 60 LYS n 1 61 ASP n 1 62 GLU n 1 63 ALA n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 ASN n 1 69 GLN n 1 70 ASP n 1 71 VAL n 1 72 ASP n 1 73 ALA n 1 74 ALA n 1 75 VAL n 1 76 ARG n 1 77 GLY n 1 78 ILE n 1 79 LEU n 1 80 ARG n 1 81 ASN n 1 82 ALA n 1 83 LYS n 1 84 LEU n 1 85 LYS n 1 86 PRO n 1 87 VAL n 1 88 TYR n 1 89 ASP n 1 90 SER n 1 91 LEU n 1 92 ASP n 1 93 ALA n 1 94 VAL n 1 95 ARG n 1 96 ARG n 1 97 CYS n 1 98 ALA n 1 99 LEU n 1 100 ILE n 1 101 ASN n 1 102 MET n 1 103 VAL n 1 104 PHE n 1 105 GLN n 1 106 MET n 1 107 GLY n 1 108 GLU n 1 109 THR n 1 110 GLY n 1 111 VAL n 1 112 ALA n 1 113 GLY n 1 114 PHE n 1 115 THR n 1 116 ASN n 1 117 SER n 1 118 LEU n 1 119 ARG n 1 120 MET n 1 121 LEU n 1 122 GLN n 1 123 GLN n 1 124 LYS n 1 125 ARG n 1 126 TRP n 1 127 ALA n 1 128 ALA n 1 129 ALA n 1 130 ALA n 1 131 VAL n 1 132 ASN n 1 133 LEU n 1 134 ALA n 1 135 LYS n 1 136 SER n 1 137 ARG n 1 138 TRP n 1 139 TYR n 1 140 ASN n 1 141 GLN n 1 142 THR n 1 143 PRO n 1 144 ASN n 1 145 ARG n 1 146 ALA n 1 147 LYS n 1 148 ARG n 1 149 VAL n 1 150 ILE n 1 151 THR n 1 152 THR n 1 153 PHE n 1 154 ARG n 1 155 THR n 1 156 GLY n 1 157 THR n 1 158 TRP n 1 159 ASP n 1 160 ALA n 1 161 TYR n 1 162 LYS n 1 163 ASN n 1 164 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'T4-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Enterobacteria phage T4 sensu lato' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYS_BPT4 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00720 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L72 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 164 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00720 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1L72 ALA A 127 ? UNP P00720 ASP 127 CONFLICT 127 1 1 1L72 ALA A 128 ? UNP P00720 GLU 128 CONFLICT 128 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1L72 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.78 _exptl_crystal.density_percent_sol 55.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1L72 _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.0 _refine.ls_d_res_high 1.85 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.168 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;RESIDUES 162 - 164 IN WILD-TYPE AND ALL MUTANT LYSOZYMES ARE EXTREMELY MOBILE. THUS THE COORDINATES FOR THESE RESIDUES ARE VERY UNRELIABLE. THIS ENTRY DOES NOT INCLUDE RESIDUES 163 AND 164. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1285 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 137 _refine_hist.number_atoms_total 1432 _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 6.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.015 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 2.3 ? ? ? 'X-RAY DIFFRACTION' ? t_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_gen_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_it ? ? ? ? 'X-RAY DIFFRACTION' ? t_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1L72 _struct.title ;MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY ; _struct.pdbx_descriptor 'LYSOZYME (E.C.3.2.1.17) (MUTANT WITH ASP 127 REPLACED BY ALA, GLU 128 REPLACED BY ALA) (D127A,E128A)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L72 _struct_keywords.pdbx_keywords 'HYDROLASE (O-GLYCOSYL)' _struct_keywords.text 'HYDROLASE (O-GLYCOSYL)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ILE A 3 ? GLU A 11 ? ILE A 3 GLU A 11 1 ? 9 HELX_P HELX_P2 H2 LEU A 39 ? ILE A 50 ? LEU A 39 ILE A 50 1 ? 12 HELX_P HELX_P3 H3 LYS A 60 ? ARG A 80 ? LYS A 60 ARG A 80 1 ? 21 HELX_P HELX_P4 H4 ALA A 82 ? SER A 90 ? ALA A 82 SER A 90 1 ? 9 HELX_P HELX_P5 H5 ALA A 93 ? MET A 106 ? ALA A 93 MET A 106 1 ? 14 HELX_P HELX_P6 H6 GLU A 108 ? GLY A 113 ? GLU A 108 GLY A 113 1 ? 6 HELX_P HELX_P7 H7 THR A 115 ? GLN A 123 ? THR A 115 GLN A 123 1 ? 9 HELX_P HELX_P8 H8 TRP A 126 ? ALA A 134 ? TRP A 126 ALA A 134 1 ? 9 HELX_P HELX_P9 H9 ARG A 137 ? GLN A 141 ? ARG A 137 GLN A 141 1 ? 5 HELX_P HELX_P10 H10 PRO A 143 ? THR A 155 ? PRO A 143 THR A 155 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A CYS 97 SG ? ? ? 1_555 D BME . S2 ? ? A CYS 97 A BME 179 1_555 ? ? ? ? ? ? ? 2.108 ? covale2 covale ? ? E BME . S2 ? ? ? 1_555 E BME . S2 ? ? A BME 900 A BME 900 5_555 ? ? ? ? ? ? ? 1.925 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 GLY A 56 ? ILE A 58 ? GLY A 56 ILE A 58 S1 2 ARG A 14 ? ASP A 20 ? ARG A 14 ASP A 20 S1 3 TYR A 24 ? ILE A 27 ? TYR A 24 ILE A 27 S1 4 HIS A 31 ? LEU A 33 ? HIS A 31 LEU A 33 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N ILE A 58 ? N ILE A 58 O LEU A 15 ? O LEU A 15 S1 2 3 N ASP A 20 ? N ASP A 20 O TYR A 24 ? O TYR A 24 S1 3 4 O ILE A 27 ? O ILE A 27 N HIS A 31 ? N HIS A 31 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A 173' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE BME A 179' AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BME A 900' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 THR A 142 ? THR A 142 . ? 1_555 ? 2 AC1 5 ASN A 144 ? ASN A 144 . ? 1_555 ? 3 AC1 5 ARG A 145 ? ARG A 145 . ? 1_555 ? 4 AC1 5 HOH F . ? HOH A 935 . ? 1_555 ? 5 AC1 5 HOH F . ? HOH A 1015 . ? 4_655 ? 6 AC2 6 ILE A 3 ? ILE A 3 . ? 1_555 ? 7 AC2 6 ASN A 68 ? ASN A 68 . ? 5_555 ? 8 AC2 6 ALA A 93 ? ALA A 93 . ? 1_555 ? 9 AC2 6 CYS A 97 ? CYS A 97 . ? 1_555 ? 10 AC2 6 BME E . ? BME A 900 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 923 . ? 1_555 ? 12 AC3 2 ASP A 72 ? ASP A 72 . ? 5_555 ? 13 AC3 2 BME D . ? BME A 179 . ? 1_555 ? # _database_PDB_matrix.entry_id 1L72 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1L72 _atom_sites.fract_transf_matrix[1][1] 0.016367 _atom_sites.fract_transf_matrix[1][2] 0.009449 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018899 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010444 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 ;RESIDUES 162 - 164 IN WILD-TYPE AND ALL MUTANT LYSOZYMES ARE EXTREMELY MOBILE. THUS THE COORDINATES FOR THESE RESIDUES ARE VERY UNRELIABLE. THIS ENTRY DOES NOT INCLUDE RESIDUES 163 AND 164. ; 2 'SG SEO 97 IS BONDED TO SG CYS 97.' 3 'SEO 900 IS BONDED TO ANOTHER SEO FROM A DIFFERENT ASYMMETRIC UNIT.' # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ASN 163 163 ? ? ? A . n A 1 164 LEU 164 164 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 173 173 CL CL A . C 2 CL 1 178 178 CL CL A . D 3 BME 1 179 97 BME SEO A . E 3 BME 1 900 900 BME SEO A . F 4 HOH 1 901 171 HOH HOH A . F 4 HOH 2 902 172 HOH HOH A . F 4 HOH 3 903 174 HOH HOH A . F 4 HOH 4 904 175 HOH HOH A . F 4 HOH 5 905 176 HOH HOH A . F 4 HOH 6 906 177 HOH HOH A . F 4 HOH 7 907 179 HOH HOH A . F 4 HOH 8 908 180 HOH HOH A . F 4 HOH 9 909 181 HOH HOH A . F 4 HOH 10 910 182 HOH HOH A . F 4 HOH 11 911 183 HOH HOH A . F 4 HOH 12 912 184 HOH HOH A . F 4 HOH 13 913 185 HOH HOH A . F 4 HOH 14 914 186 HOH HOH A . F 4 HOH 15 915 187 HOH HOH A . F 4 HOH 16 916 188 HOH HOH A . F 4 HOH 17 917 189 HOH HOH A . F 4 HOH 18 918 190 HOH HOH A . F 4 HOH 19 919 191 HOH HOH A . F 4 HOH 20 920 192 HOH HOH A . F 4 HOH 21 921 193 HOH HOH A . F 4 HOH 22 922 194 HOH HOH A . F 4 HOH 23 923 195 HOH HOH A . F 4 HOH 24 924 196 HOH HOH A . F 4 HOH 25 925 197 HOH HOH A . F 4 HOH 26 926 198 HOH HOH A . F 4 HOH 27 927 200 HOH HOH A . F 4 HOH 28 928 201 HOH HOH A . F 4 HOH 29 929 202 HOH HOH A . F 4 HOH 30 930 203 HOH HOH A . F 4 HOH 31 931 204 HOH HOH A . F 4 HOH 32 932 206 HOH HOH A . F 4 HOH 33 933 207 HOH HOH A . F 4 HOH 34 934 208 HOH HOH A . F 4 HOH 35 935 209 HOH HOH A . F 4 HOH 36 936 210 HOH HOH A . F 4 HOH 37 937 211 HOH HOH A . F 4 HOH 38 938 212 HOH HOH A . F 4 HOH 39 939 213 HOH HOH A . F 4 HOH 40 940 214 HOH HOH A . F 4 HOH 41 941 215 HOH HOH A . F 4 HOH 42 942 216 HOH HOH A . F 4 HOH 43 943 217 HOH HOH A . F 4 HOH 44 944 218 HOH HOH A . F 4 HOH 45 945 219 HOH HOH A . F 4 HOH 46 946 220 HOH HOH A . F 4 HOH 47 947 221 HOH HOH A . F 4 HOH 48 948 222 HOH HOH A . F 4 HOH 49 949 223 HOH HOH A . F 4 HOH 50 950 224 HOH HOH A . F 4 HOH 51 951 225 HOH HOH A . F 4 HOH 52 952 226 HOH HOH A . F 4 HOH 53 953 227 HOH HOH A . F 4 HOH 54 954 228 HOH HOH A . F 4 HOH 55 955 229 HOH HOH A . F 4 HOH 56 956 230 HOH HOH A . F 4 HOH 57 957 231 HOH HOH A . F 4 HOH 58 958 232 HOH HOH A . F 4 HOH 59 959 233 HOH HOH A . F 4 HOH 60 960 234 HOH HOH A . F 4 HOH 61 961 235 HOH HOH A . F 4 HOH 62 962 236 HOH HOH A . F 4 HOH 63 963 237 HOH HOH A . F 4 HOH 64 964 238 HOH HOH A . F 4 HOH 65 965 239 HOH HOH A . F 4 HOH 66 966 240 HOH HOH A . F 4 HOH 67 967 242 HOH HOH A . F 4 HOH 68 968 244 HOH HOH A . F 4 HOH 69 969 245 HOH HOH A . F 4 HOH 70 970 246 HOH HOH A . F 4 HOH 71 971 247 HOH HOH A . F 4 HOH 72 972 248 HOH HOH A . F 4 HOH 73 973 249 HOH HOH A . F 4 HOH 74 974 250 HOH HOH A . F 4 HOH 75 975 251 HOH HOH A . F 4 HOH 76 976 252 HOH HOH A . F 4 HOH 77 977 253 HOH HOH A . F 4 HOH 78 978 254 HOH HOH A . F 4 HOH 79 979 255 HOH HOH A . F 4 HOH 80 980 256 HOH HOH A . F 4 HOH 81 981 257 HOH HOH A . F 4 HOH 82 982 258 HOH HOH A . F 4 HOH 83 983 259 HOH HOH A . F 4 HOH 84 984 260 HOH HOH A . F 4 HOH 85 985 261 HOH HOH A . F 4 HOH 86 986 262 HOH HOH A . F 4 HOH 87 987 263 HOH HOH A . F 4 HOH 88 988 264 HOH HOH A . F 4 HOH 89 989 265 HOH HOH A . F 4 HOH 90 990 266 HOH HOH A . F 4 HOH 91 991 267 HOH HOH A . F 4 HOH 92 992 268 HOH HOH A . F 4 HOH 93 993 269 HOH HOH A . F 4 HOH 94 994 270 HOH HOH A . F 4 HOH 95 995 271 HOH HOH A . F 4 HOH 96 996 272 HOH HOH A . F 4 HOH 97 997 273 HOH HOH A . F 4 HOH 98 998 274 HOH HOH A . F 4 HOH 99 999 275 HOH HOH A . F 4 HOH 100 1000 276 HOH HOH A . F 4 HOH 101 1001 277 HOH HOH A . F 4 HOH 102 1002 278 HOH HOH A . F 4 HOH 103 1003 279 HOH HOH A . F 4 HOH 104 1004 280 HOH HOH A . F 4 HOH 105 1005 281 HOH HOH A . F 4 HOH 106 1006 282 HOH HOH A . F 4 HOH 107 1007 283 HOH HOH A . F 4 HOH 108 1008 284 HOH HOH A . F 4 HOH 109 1009 285 HOH HOH A . F 4 HOH 110 1010 286 HOH HOH A . F 4 HOH 111 1011 287 HOH HOH A . F 4 HOH 112 1012 288 HOH HOH A . F 4 HOH 113 1013 289 HOH HOH A . F 4 HOH 114 1014 290 HOH HOH A . F 4 HOH 115 1015 291 HOH HOH A . F 4 HOH 116 1016 292 HOH HOH A . F 4 HOH 117 1017 293 HOH HOH A . F 4 HOH 118 1018 294 HOH HOH A . F 4 HOH 119 1019 295 HOH HOH A . F 4 HOH 120 1020 296 HOH HOH A . F 4 HOH 121 1021 298 HOH HOH A . F 4 HOH 122 1022 299 HOH HOH A . F 4 HOH 123 1023 300 HOH HOH A . F 4 HOH 124 1024 302 HOH HOH A . F 4 HOH 125 1025 303 HOH HOH A . F 4 HOH 126 1026 304 HOH HOH A . F 4 HOH 127 1027 306 HOH HOH A . F 4 HOH 128 1028 307 HOH HOH A . F 4 HOH 129 1029 308 HOH HOH A . F 4 HOH 130 1030 309 HOH HOH A . F 4 HOH 131 1031 311 HOH HOH A . F 4 HOH 132 1032 312 HOH HOH A . F 4 HOH 133 1033 313 HOH HOH A . F 4 HOH 134 1034 314 HOH HOH A . F 4 HOH 135 1035 315 HOH HOH A . F 4 HOH 136 1036 316 HOH HOH A . F 4 HOH 137 1037 317 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1991-10-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # _software.name TNT _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET THERE ARE SEVERAL SUBTLE ASPECTS OF THE SECONDARY STRUCTURE OF THIS MOLECULE WHICH CANNOT CONVENIENTLY BE REPRESENTED IN THE HELIX AND SHEET RECORDS BELOW. THESE ASPECTS INFLUENCE THE REPRESENTATION OF HELIX 6 AND STRAND 3 OF SHEET *S1*. THE PAPER CITED AS REFERENCE 26 ABOVE SHOULD BE CONSULTED FOR THESE SUBTLETIES. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CB A MET 102 ? ? O A HOH 1036 ? ? 1.26 2 1 CB A THR 21 ? ? O A HOH 1032 ? ? 1.40 3 1 SD A MET 106 ? ? O A HOH 1034 ? ? 1.74 4 1 CG A MET 102 ? ? O A HOH 1036 ? ? 1.81 5 1 CB A MET 106 ? ? O A HOH 1034 ? ? 2.04 6 1 CG2 A THR 21 ? ? O A HOH 1032 ? ? 2.10 7 1 CG A MET 106 ? ? O A HOH 1034 ? ? 2.12 8 1 CE A MET 106 ? ? O A HOH 1034 ? ? 2.14 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 1012 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 1012 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 1.92 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.11 120.30 3.81 0.50 N 2 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH2 A ARG 8 ? ? 116.96 120.30 -3.34 0.50 N 3 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD1 A ASP 47 ? ? 124.50 118.30 6.20 0.90 N 4 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD2 A ASP 47 ? ? 112.16 118.30 -6.14 0.90 N 5 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD2 A ASP 61 ? ? 112.57 118.30 -5.73 0.90 N 6 1 CB A ASP 70 ? ? CG A ASP 70 ? ? OD1 A ASP 70 ? ? 124.15 118.30 5.85 0.90 N 7 1 CB A ASP 72 ? ? CG A ASP 72 ? ? OD2 A ASP 72 ? ? 112.33 118.30 -5.97 0.90 N 8 1 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.79 120.30 4.49 0.50 N 9 1 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH2 A ARG 80 ? ? 116.65 120.30 -3.65 0.50 N 10 1 CB A ASP 92 ? ? CG A ASP 92 ? ? OD1 A ASP 92 ? ? 123.90 118.30 5.60 0.90 N 11 1 NE A ARG 125 ? ? CZ A ARG 125 ? ? NH1 A ARG 125 ? ? 124.38 120.30 4.08 0.50 N 12 1 CD A ARG 145 ? ? NE A ARG 145 ? ? CZ A ARG 145 ? ? 114.09 123.60 -9.51 1.40 N 13 1 NE A ARG 145 ? ? CZ A ARG 145 ? ? NH1 A ARG 145 ? ? 116.99 120.30 -3.31 0.50 N 14 1 NE A ARG 154 ? ? CZ A ARG 154 ? ? NH1 A ARG 154 ? ? 124.28 120.30 3.98 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 29 ? ? -100.54 76.22 2 1 PHE A 114 ? ? -90.58 53.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 163 ? A ASN 163 2 1 Y 1 A LEU 164 ? A LEU 164 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 BETA-MERCAPTOETHANOL BME 4 water HOH #