data_1L8J # _entry.id 1L8J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1L8J RCSB RCSB015739 WWPDB D_1000015739 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L8J _pdbx_database_status.recvd_initial_deposition_date 2002-03-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Oganesyan, V.' 1 'Oganesyan, N.' 2 'Terzyan, S.' 3 'Dongfeng, Q.' 4 'Dauter, Z.' 5 'Esmon, N.L.' 6 'Esmon, C.T.' 7 # _citation.id primary _citation.title 'The crystal structure of the endothelial protein C receptor and a bound phospholipid.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 277 _citation.page_first 24851 _citation.page_last 24854 _citation.year 2002 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12034704 _citation.pdbx_database_id_DOI 10.1074/jbc.C200163200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Oganesyan, V.' 1 ? primary 'Oganesyan, N.' 2 ? primary 'Terzyan, S.' 3 ? primary 'Qu, D.' 4 ? primary 'Dauter, Z.' 5 ? primary 'Esmon, N.L.' 6 ? primary 'Esmon, C.T.' 7 ? # _cell.entry_id 1L8J _cell.length_a 69.710 _cell.length_b 69.710 _cell.length_c 96.210 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1L8J _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Endothelial protein C receptor' 22046.562 1 ? ? 'Extracellular domain (residues 18-210)' ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 2 ? ? ? ? 3 branched man '2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 4 non-polymer syn PHOSPHATIDYLETHANOLAMINE 734.039 1 ? ? ? ? 5 water nat water 18.015 107 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Endothelial cell protein C receptor, Activated protein C receptor, APC receptor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLV RLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYE LREFLEDTCVQYVQKHISAENTKGSQTSRSYTS ; _entity_poly.pdbx_seq_one_letter_code_can ;SQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLV RLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYE LREFLEDTCVQYVQKHISAENTKGSQTSRSYTS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLN n 1 3 ASP n 1 4 ALA n 1 5 SER n 1 6 ASP n 1 7 GLY n 1 8 LEU n 1 9 GLN n 1 10 ARG n 1 11 LEU n 1 12 HIS n 1 13 MET n 1 14 LEU n 1 15 GLN n 1 16 ILE n 1 17 SER n 1 18 TYR n 1 19 PHE n 1 20 ARG n 1 21 ASP n 1 22 PRO n 1 23 TYR n 1 24 HIS n 1 25 VAL n 1 26 TRP n 1 27 TYR n 1 28 GLN n 1 29 GLY n 1 30 ASN n 1 31 ALA n 1 32 SER n 1 33 LEU n 1 34 GLY n 1 35 GLY n 1 36 HIS n 1 37 LEU n 1 38 THR n 1 39 HIS n 1 40 VAL n 1 41 LEU n 1 42 GLU n 1 43 GLY n 1 44 PRO n 1 45 ASP n 1 46 THR n 1 47 ASN n 1 48 THR n 1 49 THR n 1 50 ILE n 1 51 ILE n 1 52 GLN n 1 53 LEU n 1 54 GLN n 1 55 PRO n 1 56 LEU n 1 57 GLN n 1 58 GLU n 1 59 PRO n 1 60 GLU n 1 61 SER n 1 62 TRP n 1 63 ALA n 1 64 ARG n 1 65 THR n 1 66 GLN n 1 67 SER n 1 68 GLY n 1 69 LEU n 1 70 GLN n 1 71 SER n 1 72 TYR n 1 73 LEU n 1 74 LEU n 1 75 GLN n 1 76 PHE n 1 77 HIS n 1 78 GLY n 1 79 LEU n 1 80 VAL n 1 81 ARG n 1 82 LEU n 1 83 VAL n 1 84 HIS n 1 85 GLN n 1 86 GLU n 1 87 ARG n 1 88 THR n 1 89 LEU n 1 90 ALA n 1 91 PHE n 1 92 PRO n 1 93 LEU n 1 94 THR n 1 95 ILE n 1 96 ARG n 1 97 CYS n 1 98 PHE n 1 99 LEU n 1 100 GLY n 1 101 CYS n 1 102 GLU n 1 103 LEU n 1 104 PRO n 1 105 PRO n 1 106 GLU n 1 107 GLY n 1 108 SER n 1 109 ARG n 1 110 ALA n 1 111 HIS n 1 112 VAL n 1 113 PHE n 1 114 PHE n 1 115 GLU n 1 116 VAL n 1 117 ALA n 1 118 VAL n 1 119 ASN n 1 120 GLY n 1 121 SER n 1 122 SER n 1 123 PHE n 1 124 VAL n 1 125 SER n 1 126 PHE n 1 127 ARG n 1 128 PRO n 1 129 GLU n 1 130 ARG n 1 131 ALA n 1 132 LEU n 1 133 TRP n 1 134 GLN n 1 135 ALA n 1 136 ASP n 1 137 THR n 1 138 GLN n 1 139 VAL n 1 140 THR n 1 141 SER n 1 142 GLY n 1 143 VAL n 1 144 VAL n 1 145 THR n 1 146 PHE n 1 147 THR n 1 148 LEU n 1 149 GLN n 1 150 GLN n 1 151 LEU n 1 152 ASN n 1 153 ALA n 1 154 TYR n 1 155 ASN n 1 156 ARG n 1 157 THR n 1 158 ARG n 1 159 TYR n 1 160 GLU n 1 161 LEU n 1 162 ARG n 1 163 GLU n 1 164 PHE n 1 165 LEU n 1 166 GLU n 1 167 ASP n 1 168 THR n 1 169 CYS n 1 170 VAL n 1 171 GLN n 1 172 TYR n 1 173 VAL n 1 174 GLN n 1 175 LYS n 1 176 HIS n 1 177 ILE n 1 178 SER n 1 179 ALA n 1 180 GLU n 1 181 ASN n 1 182 THR n 1 183 LYS n 1 184 GLY n 1 185 SER n 1 186 GLN n 1 187 THR n 1 188 SER n 1 189 ARG n 1 190 SER n 1 191 TYR n 1 192 THR n 1 193 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Chinese hamster' _entity_src_gen.pdbx_host_org_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10029 _entity_src_gen.host_org_genus Cricetulus _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pEEhsEPCR _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EPCR_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLV RLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYE LREFLEDTCVQYVQKHISAENTKGSQTSRSYTS ; _struct_ref.pdbx_align_begin 18 _struct_ref.pdbx_db_accession Q9UNN8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L8J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 193 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UNN8 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 210 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 193 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTY non-polymer . PHOSPHATIDYLETHANOLAMINE ? 'C40 H80 N O8 P' 734.039 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1L8J _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 3 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 47 _exptl_crystal.density_Matthews 3.06 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'Sodium Formate, TRIS-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 110.0 ? 1 2 ? ? 1 3 ? ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD 'ADSC QUANTUM 4' 2001-03-20 ? 2 'AREA DETECTOR' MARRESEARCH 2001-04-15 ? 3 'AREA DETECTOR' MARRESEARCH 2001-06-18 ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M graphite 'SINGLE WAVELENGTH' x-ray 2 1 M CuKa 'SINGLE WAVELENGTH' x-ray 3 1 M CuKa 'SINGLE WAVELENGTH' x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.03 1.0 2 1.5418 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'NSLS BEAMLINE X9B' NSLS X9B ? 1.03 2 'ROTATING ANODE' 'RIGAKU RU300' ? ? 1.5418 ? # _reflns.entry_id 1L8J _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 30.0 _reflns.d_resolution_high 2.0 _reflns.number_obs 18663 _reflns.number_all 18798 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.038 _reflns.pdbx_Rsym_value 0.038 _reflns.pdbx_netI_over_sigmaI 40 _reflns.B_iso_Wilson_estimate 25 _reflns.pdbx_redundancy 5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1,2,3 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_obs 0.257 _reflns_shell.pdbx_Rsym_value 0.257 _reflns_shell.meanI_over_sigI_obs 5 _reflns_shell.pdbx_redundancy 4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 18798 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1,2,3 # _refine.entry_id 1L8J _refine.ls_number_reflns_obs 18663 _refine.ls_number_reflns_all 18798 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 12.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.195 _refine.ls_R_factor_R_free 0.211 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 933 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 30 _refine.aniso_B[1][1] -2.184 _refine.aniso_B[2][2] -2.184 _refine.aniso_B[3][3] 4.369 _refine.aniso_B[1][2] -0.826 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model Isotropic _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1,2,3 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1391 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 134 _refine_hist.number_atoms_solvent 107 _refine_hist.number_atoms_total 1632 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 12.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.012 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.55 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1L8J _struct.title 'Crystal Structure of the Endothelial Protein C Receptor and Bound Phospholipid Molecule' _struct.pdbx_descriptor 'Endothelial protein C receptor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L8J _struct_keywords.pdbx_keywords 'BLOOD CLOTTING' _struct_keywords.text 'protein-lipid complex, glycosilation, MHC class1, hydrophobic groove, BLOOD CLOTTING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 2 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a membrane bound monomer with transmembrane domain and short cytoplasmic domain.' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 58 ? THR A 88 ? GLU A 58 THR A 88 1 ? 31 HELX_P HELX_P2 2 PRO A 128 ? ALA A 131 ? PRO A 128 ALA A 131 5 ? 4 HELX_P HELX_P3 3 SER A 141 ? ASN A 152 ? SER A 141 ASN A 152 1 ? 12 HELX_P HELX_P4 4 ASN A 155 ? ASP A 167 ? ASN A 155 ASP A 167 1 ? 13 HELX_P HELX_P5 5 ASP A 167 ? ILE A 177 ? ASP A 167 ILE A 177 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 101 SG ? ? ? 1_555 A CYS 169 SG ? ? A CYS 101 A CYS 169 1_555 ? ? ? ? ? ? ? 2.252 ? ? covale1 covale one ? A ASN 30 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 30 B NAG 1 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation covale2 covale one ? A ASN 47 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 47 C NAG 1 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation covale3 covale one ? A ASN 119 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 119 D NAG 1 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation covale4 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.387 ? ? covale5 covale both ? C NAG . O4 ? ? ? 1_555 C NDG . C1 ? ? C NAG 1 C NDG 2 1_555 ? ? ? ? ? ? ? 1.396 ? ? covale6 covale both ? D NAG . O4 ? ? ? 1_555 D NAG . C1 ? ? D NAG 1 D NAG 2 1_555 ? ? ? ? ? ? ? 1.383 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 91 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 91 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 92 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 92 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.26 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 49 ? GLN A 52 ? THR A 49 GLN A 52 A 2 HIS A 36 ? PRO A 44 ? HIS A 36 PRO A 44 A 3 HIS A 24 ? LEU A 33 ? HIS A 24 LEU A 33 A 4 GLN A 9 ? ASP A 21 ? GLN A 9 ASP A 21 A 5 LEU A 93 ? LEU A 103 ? LEU A 93 LEU A 103 A 6 HIS A 111 ? VAL A 118 ? HIS A 111 VAL A 118 A 7 SER A 121 ? ARG A 127 ? SER A 121 ARG A 127 A 8 LEU A 132 ? ALA A 135 ? LEU A 132 ALA A 135 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 49 ? O THR A 49 N GLU A 42 ? N GLU A 42 A 2 3 O GLY A 43 ? O GLY A 43 N TYR A 27 ? N TYR A 27 A 3 4 O ASN A 30 ? O ASN A 30 N LEU A 14 ? N LEU A 14 A 4 5 N SER A 17 ? N SER A 17 O ILE A 95 ? O ILE A 95 A 5 6 N PHE A 98 ? N PHE A 98 O GLU A 115 ? O GLU A 115 A 6 7 N VAL A 116 ? N VAL A 116 O VAL A 124 ? O VAL A 124 A 7 8 N SER A 125 ? N SER A 125 O GLN A 134 ? O GLN A 134 # _database_PDB_matrix.entry_id 1L8J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1L8J _atom_sites.fract_transf_matrix[1][1] 0.014345 _atom_sites.fract_transf_matrix[1][2] 0.008281 _atom_sites.fract_transf_matrix[1][3] -0.000001 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016564 _atom_sites.fract_transf_matrix[2][3] -0.000001 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010394 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _database_PDB_caveat.text 'NAG C 1 HAS WRONG CHIRALITY AT ATOM C1' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 GLN 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ILE 51 51 51 ILE THR A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 GLN 171 171 171 GLN GLN A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 ALA 179 179 ? ? ? A . n A 1 180 GLU 180 180 ? ? ? A . n A 1 181 ASN 181 181 ? ? ? A . n A 1 182 THR 182 182 ? ? ? A . n A 1 183 LYS 183 183 ? ? ? A . n A 1 184 GLY 184 184 ? ? ? A . n A 1 185 SER 185 185 ? ? ? A . n A 1 186 GLN 186 186 ? ? ? A . n A 1 187 THR 187 187 ? ? ? A . n A 1 188 SER 188 188 ? ? ? A . n A 1 189 ARG 189 189 ? ? ? A . n A 1 190 SER 190 190 ? ? ? A . n A 1 191 TYR 191 191 ? ? ? A . n A 1 192 THR 192 192 ? ? ? A . n A 1 193 SER 193 193 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 4 PTY 1 200 1 PTY PEE A . F 5 HOH 1 201 188 HOH WAT A . F 5 HOH 2 202 189 HOH WAT A . F 5 HOH 3 203 190 HOH WAT A . F 5 HOH 4 204 191 HOH WAT A . F 5 HOH 5 205 192 HOH WAT A . F 5 HOH 6 206 193 HOH WAT A . F 5 HOH 7 207 194 HOH WAT A . F 5 HOH 8 208 195 HOH WAT A . F 5 HOH 9 209 196 HOH WAT A . F 5 HOH 10 210 197 HOH WAT A . F 5 HOH 11 211 198 HOH WAT A . F 5 HOH 12 212 199 HOH WAT A . F 5 HOH 13 213 200 HOH WAT A . F 5 HOH 14 214 201 HOH WAT A . F 5 HOH 15 215 202 HOH WAT A . F 5 HOH 16 216 203 HOH WAT A . F 5 HOH 17 217 204 HOH WAT A . F 5 HOH 18 218 205 HOH WAT A . F 5 HOH 19 219 206 HOH WAT A . F 5 HOH 20 220 207 HOH WAT A . F 5 HOH 21 221 208 HOH WAT A . F 5 HOH 22 222 209 HOH WAT A . F 5 HOH 23 223 210 HOH WAT A . F 5 HOH 24 224 212 HOH WAT A . F 5 HOH 25 225 213 HOH WAT A . F 5 HOH 26 226 214 HOH WAT A . F 5 HOH 27 227 215 HOH WAT A . F 5 HOH 28 228 216 HOH WAT A . F 5 HOH 29 229 217 HOH WAT A . F 5 HOH 30 230 219 HOH WAT A . F 5 HOH 31 231 220 HOH WAT A . F 5 HOH 32 232 221 HOH WAT A . F 5 HOH 33 233 222 HOH WAT A . F 5 HOH 34 234 223 HOH WAT A . F 5 HOH 35 235 224 HOH WAT A . F 5 HOH 36 236 225 HOH WAT A . F 5 HOH 37 237 226 HOH WAT A . F 5 HOH 38 238 227 HOH WAT A . F 5 HOH 39 239 228 HOH WAT A . F 5 HOH 40 240 229 HOH WAT A . F 5 HOH 41 241 230 HOH WAT A . F 5 HOH 42 242 231 HOH WAT A . F 5 HOH 43 243 232 HOH WAT A . F 5 HOH 44 244 233 HOH WAT A . F 5 HOH 45 245 234 HOH WAT A . F 5 HOH 46 246 235 HOH WAT A . F 5 HOH 47 247 236 HOH WAT A . F 5 HOH 48 248 237 HOH WAT A . F 5 HOH 49 249 238 HOH WAT A . F 5 HOH 50 250 239 HOH WAT A . F 5 HOH 51 251 240 HOH WAT A . F 5 HOH 52 252 241 HOH WAT A . F 5 HOH 53 253 242 HOH WAT A . F 5 HOH 54 254 243 HOH WAT A . F 5 HOH 55 255 244 HOH WAT A . F 5 HOH 56 256 245 HOH WAT A . F 5 HOH 57 257 246 HOH WAT A . F 5 HOH 58 258 247 HOH WAT A . F 5 HOH 59 259 248 HOH WAT A . F 5 HOH 60 260 249 HOH WAT A . F 5 HOH 61 261 250 HOH WAT A . F 5 HOH 62 262 251 HOH WAT A . F 5 HOH 63 263 252 HOH WAT A . F 5 HOH 64 264 253 HOH WAT A . F 5 HOH 65 265 254 HOH WAT A . F 5 HOH 66 266 255 HOH WAT A . F 5 HOH 67 267 256 HOH WAT A . F 5 HOH 68 268 257 HOH WAT A . F 5 HOH 69 269 258 HOH WAT A . F 5 HOH 70 270 259 HOH WAT A . F 5 HOH 71 271 260 HOH WAT A . F 5 HOH 72 272 261 HOH WAT A . F 5 HOH 73 273 262 HOH WAT A . F 5 HOH 74 274 263 HOH WAT A . F 5 HOH 75 275 264 HOH WAT A . F 5 HOH 76 276 265 HOH WAT A . F 5 HOH 77 277 266 HOH WAT A . F 5 HOH 78 278 267 HOH WAT A . F 5 HOH 79 279 268 HOH WAT A . F 5 HOH 80 280 269 HOH WAT A . F 5 HOH 81 281 270 HOH WAT A . F 5 HOH 82 282 271 HOH WAT A . F 5 HOH 83 283 272 HOH WAT A . F 5 HOH 84 284 273 HOH WAT A . F 5 HOH 85 285 274 HOH WAT A . F 5 HOH 86 286 275 HOH WAT A . F 5 HOH 87 287 276 HOH WAT A . F 5 HOH 88 288 277 HOH WAT A . F 5 HOH 89 289 278 HOH WAT A . F 5 HOH 90 290 279 HOH WAT A . F 5 HOH 91 291 280 HOH WAT A . F 5 HOH 92 292 291 HOH WAT A . F 5 HOH 93 293 292 HOH WAT A . F 5 HOH 94 294 293 HOH WAT A . F 5 HOH 95 295 294 HOH WAT A . F 5 HOH 96 296 295 HOH WAT A . F 5 HOH 97 297 296 HOH WAT A . F 5 HOH 98 298 297 HOH WAT A . F 5 HOH 99 299 298 HOH WAT A . F 5 HOH 100 300 301 HOH WAT A . F 5 HOH 101 301 302 HOH WAT A . F 5 HOH 102 302 303 HOH WAT A . F 5 HOH 103 303 304 HOH WAT A . F 5 HOH 104 304 305 HOH WAT A . F 5 HOH 105 305 306 HOH WAT A . F 5 HOH 106 306 307 HOH WAT A . F 5 HOH 107 307 308 HOH WAT A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ASN 30 A ASN 30 ? ASN 'GLYCOSYLATION SITE' 2 A ASN 47 A ASN 47 ? ASN 'GLYCOSYLATION SITE' 3 A ASN 119 A ASN 119 ? ASN 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-06-26 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Atomic model' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' database_PDB_caveat 4 4 'Structure model' entity 5 4 'Structure model' pdbx_branch_scheme 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_entity_branch 8 4 'Structure model' pdbx_entity_branch_descriptor 9 4 'Structure model' pdbx_entity_branch_link 10 4 'Structure model' pdbx_entity_branch_list 11 4 'Structure model' pdbx_entity_nonpoly 12 4 'Structure model' pdbx_nonpoly_scheme 13 4 'Structure model' pdbx_struct_assembly_gen 14 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 15 4 'Structure model' pdbx_unobs_or_zero_occ_residues 16 4 'Structure model' pdbx_validate_chiral 17 4 'Structure model' struct_asym 18 4 'Structure model' struct_conn 19 4 'Structure model' struct_site 20 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_asym_id' 6 4 'Structure model' '_atom_site.auth_atom_id' 7 4 'Structure model' '_atom_site.auth_comp_id' 8 4 'Structure model' '_atom_site.auth_seq_id' 9 4 'Structure model' '_atom_site.label_asym_id' 10 4 'Structure model' '_atom_site.label_atom_id' 11 4 'Structure model' '_atom_site.label_comp_id' 12 4 'Structure model' '_atom_site.type_symbol' 13 4 'Structure model' '_chem_comp.name' 14 4 'Structure model' '_chem_comp.type' 15 4 'Structure model' '_entity.formula_weight' 16 4 'Structure model' '_entity.pdbx_description' 17 4 'Structure model' '_entity.pdbx_number_of_molecules' 18 4 'Structure model' '_entity.type' 19 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 20 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 21 4 'Structure model' '_struct_conn.pdbx_role' 22 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 23 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 CNS refinement . ? 3 CNS phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ALA 135 ? ? O A HOH 305 ? ? 2.16 2 1 O A HOH 208 ? ? O A HOH 226 ? ? 2.17 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 127 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 127 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 127 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 92.10 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -18.90 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 47 ? ? -161.72 82.74 2 1 THR A 88 ? ? 67.17 112.77 3 1 PHE A 114 ? ? -163.18 107.62 4 1 PHE A 123 ? ? -127.12 -72.92 5 1 THR A 157 ? ? -57.56 0.01 6 1 ARG A 158 ? ? -117.39 -78.00 7 1 ASP A 167 ? ? -108.40 -64.63 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C1 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id C _pdbx_validate_chiral.auth_comp_id NAG _pdbx_validate_chiral.auth_seq_id 1 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id ILE _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 51 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id CD1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id ILE _pdbx_unobs_or_zero_occ_atoms.label_seq_id 51 _pdbx_unobs_or_zero_occ_atoms.label_atom_id CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A GLN 2 ? A GLN 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A SER 178 ? A SER 178 9 1 Y 1 A ALA 179 ? A ALA 179 10 1 Y 1 A GLU 180 ? A GLU 180 11 1 Y 1 A ASN 181 ? A ASN 181 12 1 Y 1 A THR 182 ? A THR 182 13 1 Y 1 A LYS 183 ? A LYS 183 14 1 Y 1 A GLY 184 ? A GLY 184 15 1 Y 1 A SER 185 ? A SER 185 16 1 Y 1 A GLN 186 ? A GLN 186 17 1 Y 1 A THR 187 ? A THR 187 18 1 Y 1 A SER 188 ? A SER 188 19 1 Y 1 A ARG 189 ? A ARG 189 20 1 Y 1 A SER 190 ? A SER 190 21 1 Y 1 A TYR 191 ? A TYR 191 22 1 Y 1 A THR 192 ? A THR 192 23 1 Y 1 A SER 193 ? A SER 193 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 B NAG 1 n B 2 NAG 2 B NAG 2 B NAG 2 n C 3 NAG 1 C NAG 1 D NAG 1 n C 3 NDG 2 C NDG 2 D NAG 2 n D 2 NAG 1 D NAG 1 E NAG 1 n D 2 NAG 2 D NAG 2 E NAG 2 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc NDG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAca NDG 'COMMON NAME' GMML 1.0 N-acetyl-a-D-glucopyranosamine NDG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-GlcpNAc NDG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_branch.entity_id _pdbx_entity_branch.type 2 oligosaccharide 3 oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? 4 3 DGlcpNAca1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 5 3 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a2122h-1a_1-5_2*NCC/3=O]/1-2/a4-b1' WURCS PDB2Glycan 1.1.0 6 3 '[]{[(4+1)][a-D-GlcpNAc]{[(4+1)][a-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 3 2 NDG C1 O1 1 NAG O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 3 NAG 1 n 3 NDG 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 PHOSPHATIDYLETHANOLAMINE PTY 5 water HOH #